KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0652Help
Entry
D11S_0652         CDS       T00993                                 

Definition
(GenBank) nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00040  Pentose and glucuronate interconversions
aat00052  Galactose metabolism
aat00500  Starch and sucrose metabolism
aat00520  Amino sugar and nucleotide sugar metabolism
aat01100  Metabolic pathways
aat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D11S_0652
   00052 Galactose metabolism
    D11S_0652
   00500 Starch and sucrose metabolism
    D11S_0652
   00520 Amino sugar and nucleotide sugar metabolism
    D11S_0652
Enzymes [BR:aat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D11S_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 CoA_binding SpoIIID
Motif
Other DBs
NCBI-ProteinID: ACX82054
UniProt: C9R2L8
Position
complement(577710..578597)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLAEFSANQKKENLALMLKRFKQTQASQIMVNPVKPEEVSSYGIADCGGV
EIPPGESAKIDSIVEKPSVDEAPSNLAVVGRYVFSATIWDLLEKTPVGVGDEIQLTDAID
MLIDKETVEAFHMTGISYDCGDKIGYMKAFVEYGLHHNKLASEFKAYLKDLVKTF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattcctgttgcaggcttaggtacacgtatgttacctgctactaaagcc
attccgaaagaaatgttaactttagtggataaaccgctaatccaatatgtggtaaatgaa
tgtgtcgccgccggtattaaagaaatcgtcctggtgactcattcctcaaaaaatgccata
gaaaaccattttgatacttccttcgaattggaaacgatgctggaaaaacgcgtaaaacgc
caattattggaagaagtgcgttccatcgtgcccaaaaatgtcacaatcatgcacgttcgc
caaggtaatgcgaaagggttggggcatgccgtattgtgcggtcgtccgctggtgggtaac
gagccttttgccgtggtgttgccggatgtgttgctggccgagttttccgctaatcagaaa
aaagaaaatctggcgttaatgttaaaacgctttaaacaaacccaagccagccaaatcatg
gtgaacccggttaaacctgaagaagtcagcagttacggtatcgccgactgtggtggtgtg
gaaattcctccgggtgaaagtgccaaaattgatagtatcgtagagaaaccaagtgtggat
gaagcaccgtctaatttggctgttgtagggcgttatgtgttctcggcaaccatttgggat
ttattggaaaagaccccggtgggcgtgggcgatgaaatccagttaaccgatgccattgat
atgctgattgataaggaaaccgtcgaagccttccacatgacaggcatttcttacgactgc
ggcgataaaatcggttatatgaaagcctttgtggagtacgggctgcaccacaataaactt
gccagtgaatttaaagcttacctcaaagatttggtgaaaacattttaa

DBGET integrated database retrieval system