KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0696Help
Entry
D11S_0696         CDS       T00993                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D11S_0696
Enzymes [BR:aat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     D11S_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627061..627807
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPDERGQQLVDMLAKAGVVAIHLPLFRIESGAELNELPNKFAQLKNGDYVFAVS
KSAVDFAFKTLTATGFVWRRDLHYFTVGQGTAQYFAATTEMPVHYPTAQENSEGLLQLSA
MRDLSDKTVLILRGNGGRELFAEQAQQRGASVETVECYRREPIVYNNAEQTSICKRAGIQ
TIVATSAEILTQLVDFVPQNEHNWLKSCQLITVSERIAHLAEALGWKNVVISPRADNQTL
LQTLLQCR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcagttttggttacccgccccgatgaacgcggtcagcagttggtggatatgttggcg
aaagccggtgttgtcgccattcatttgccgttatttcgtatcgaaagcggtgcggaactg
aatgaattgccgaataaatttgcgcagctaaaaaacggcgattatgtttttgccgtctca
aaaagtgcggtggattttgctttcaaaaccttaacggcaacagggtttgtgtggcgccgg
gatttgcattattttaccgtcggacaaggtacggcacagtatttcgccgccacgacggaa
atgccggtgcattatcccaccgcgcaggaaaacagcgaagggttattgcaattaagcgct
atgcgggatctgtccgataaaaccgtgttaattttgcgcggcaacggtgggcgtgaatta
tttgccgaacaggcgcaacagcgtggtgcgagcgtggagacagtcgaatgttatcgacgt
gagcccattgtttataataacgccgagcaaaccagcatttgtaagcgtgccggcattcaa
accattgtggcgaccagtgccgaaattctcacccaattagtggattttgtgccgcaaaat
gaacataattggttaaaaagttgtcaacttattacagtaagcgaacgaatcgcccatttg
gcggaagcgttaggctggaaaaatgtggtgatttctccgcgtgcggataatcaaacttta
ttacaaaccttattacaatgtcgttaa

DBGET integrated database retrieval system