KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0797Help
Entry
D11S_0797         CDS       T00993                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00300  Lysine biosynthesis
aat01100  Metabolic pathways
aat01120  Microbial metabolism in diverse environments
aat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    D11S_0797
Enzymes [BR:aat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     D11S_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACX82194
UniProt: C9R308
Position
723148..724281
Genome map
AA seq 377 aa AA seqDB search
MKEKVVSLAQALIRLPSISPNDEGCQQLIAERLEKLGFQIEWLPFNDTLNLWAKHGSGDP
VIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVATEEYVKAHP
NHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSTQTLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNDFFPPTSLQIANIHAG
TGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGLKYRIEWNLSGKPFLTKPGK
LVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL
GKCGQIYHQMLVNLLEH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagttgtctctttggcgcaagcattaatccgtctgccttccatcagcccg
aatgacgaaggctgccagcagctgattgcagaacggttagaaaaactcggttttcaaatt
gaatggctgccttttaacgacacgctaaatttatgggcgaaacatggcagtggcgatcct
gtcattgcctttgccgggcatacggatgtggtgccgacgggcgatgaaagccaatggact
tatccgcctttcgacgcaaaaattgtggacgatatgctttatggacgcggtgcggcggat
atgaaaggatcactggcagcaatggtagtggcaacggaagaatatgtaaaagcccatccg
aatcatcaaggcaccatcgcgttgttaattacttccgatgaagaagctgctgcgaaagac
ggcacggtgcgtgtggtggaaaccttaatggcgcgcggcgaaaagatcacttattgcatg
gtgggcgagccttccagtacgcaaaccttgggcgatgtagtgaaaaacggtcgccgtggt
tccatcacaggcaatctgtatattcagggcattcaagggcacgttgcctatccccatctg
gcggagaatcctattcacaaagccgcgccgttcttgcaggagctcaccacataccaatgg
gacaacggcaatgacttttttcctccaaccagtctgcaaatcgctaatattcatgccggc
accggcagcaataatgtgattccgggcgagctttatgtgcaatttaatttgcgttattgc
acggaagtgacggacgggatgattaagcagaaagtcgccgagatgctggaaaaacacggg
ctgaagtatcgtattgaatggaatctttccggcaagccgtttttaaccaaaccgggaaaa
ctggtgagtgcgttggtggacagcctgcaacaaatcgcaggcattacgccgaaattggaa
accggtggtggcacctcagacggacgttttattgccctcatgggcgcggaagtggtggaa
ttcggaccgcttaacgccaccattcataaagtaaacgagtgcgtgagcgtggaagatctt
ggcaaatgcggtcagatttaccatcaaatgttagtgaatttattggaacattaa

DBGET integrated database retrieval system