KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0853Help
Entry
D11S_0853         CDS       T00993                                 

Gene name
galM
Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00010  Glycolysis / Gluconeogenesis
aat00052  Galactose metabolism
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01120  Microbial metabolism in diverse environments
aat01130  Biosynthesis of antibiotics
Module
aat_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_0853 (galM)
   00052 Galactose metabolism
    D11S_0853 (galM)
Enzymes [BR:aat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     D11S_0853 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACX82249
UniProt: C9R363
Position
776256..777287
Genome map
AA seq 343 aa AA seqDB search
MLEQRAQSTAPDGLPFNLFILQNAQGMRVQFTDWGATWISCCLPVNGELREVLLGCKLED
YPVQQAYLGVSVGRYANRIANAQFPLNGKVVRLTANQGKHQLHGGNGFDKRRWTLEKCGE
NFVCFSLYSADGDQGFPGNVKATVTYTLTEDNAVKIEYAAQSDQDTALNLTNHAYFNLEN
AMQGADVRNHSLRLNADFYLPVDSEGIPNSPLKHVVGTGFDFRIAKPIKQDFLQGEQLAA
KGYDHSFIVNKAWQKPCVLLTCPNGDLSLEVLTSQAALQVYTGNFLAGTPTREGAQYADY
HGIALETQCLPDTPNHPEWQNYGGIVKAGEEYYQWTEYRFKGN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacaacgtgcacaaagcactgcaccggacggcttgccgtttaacctgtttatc
ttgcaaaacgcacaaggtatgcgcgtgcaatttaccgactggggtgcgacttggatctct
tgttgtctgccggtcaacggcgaattgcgtgaagtgctgttgggctgcaaattggaagat
tatcccgttcaacaagcctacttaggcgtgagcgtaggacgctatgccaatcgtatcgcc
aacgcgcaatttccgttgaatggcaaagttgtgcgcttaaccgccaaccaaggcaaacac
caactgcacggcggaaacggtttcgataaacgccgttggacgttggaaaagtgcggtgaa
aattttgtgtgtttttcattgtattccgccgacggcgatcaaggtttccccggcaatgtg
aaggcgacggtaacttacaccttgacggaagataatgcggttaaaatcgaatatgccgcc
caaagcgatcaggataccgcactgaatttaaccaatcacgcctatttcaatttagaaaat
gcgatgcagggcgcagatgtgcgcaaccatagcttgcgcctcaacgccgatttttattta
ccggtggatagcgaaggcattcctaactcgccgctcaaacatgttgtcggcaccggcttt
gatttccgcatagccaagccaattaaacaggattttttgcaaggagaacagcttgctgcc
aaaggctacgaccattcttttattgtgaataaagcctggcaaaaaccttgtgttctgctc
acctgtccaaacggcgatttaagcctggaagtgctgacttcacaagccgccttacaggtt
tacaccggcaacttcctcgccggcacgccgacccgtgagggtgctcaatatgccgactac
cacggcatcgccctggaaacccaatgccttcccgataccccaaatcaccccgaatggcaa
aattacggcggcattgtaaaagcaggcgaagaatattaccaatggacggaatatcgattt
aagggaaattaa

DBGET integrated database retrieval system