KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0869Help
Entry
D11S_0869         CDS       T00993                                 

Definition
Chb protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aat00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aat00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791517..792662
Genome map
AA seq 381 aa AA seqDB search
MNYIKKIILSLFLLGLFSVLNCCVKGNSIYPQKISTKQTGLMLDIARHFYSPEVIKSFID
TISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGIYINPYTGKPFLSYRQLDDI
KAYAKAKGIELIPELDSPNHMMAIFKLVQKDRGVKYLQGLKSRQVDDEIDITNADSIAFM
QSLMNEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANKLSYFLEKKGLKTRMWNDGL
IKSTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPELLAKGFTVLNYNSYYLYIV
PKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTHEIAGAALSIWGEDAKALKDE
TIQKNTKSLLEAVIHKTNGDE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaattatattaagaaaattattttatctcttttcctactgggactatttagcgtgttg
aattgttgcgtaaaaggcaattccatatatccgcaaaaaataagtaccaagcagaccgga
ttaatgctggacatcgcccgacatttttattcacccgaggtgattaaatcctttattgat
accatcagcctttccggcggtaattttctgcacctgcatttttccgaccatgaaaactat
gcgatagaaagccatttacttaatcaacgtgcggaaaatgccgtgcagggcaaagacggt
atttatattaacccttataccggaaagccattcttgagttatcggcaacttgacgatatc
aaagcctatgctaaggcaaaaggcattgagttgattcccgagcttgacagtccgaatcac
atgatggcgatctttaaactggtgcaaaaagacagaggggtcaagtatcttcaaggatta
aaatcacgccaggtagatgatgaaattgatattactaatgctgacagtattgcctttatg
caatctttaatgaatgaggttattgatatttttggcgacacgagtcagcattttcatatt
ggtggcgatgaatttggttattctgtggaaagtaatcatgagtttattacgtatgccaat
aaactatcctactttttagagaaaaaggggttgaaaacccgaatgtggaatgacggatta
attaaaagtacttttgagcaaatcaacccgaatattgaaattacttattggagctatgat
ggcgatacgcaggacaaaaatgaagctgccgagcgtcgtgatatgcgggtcagtttgccg
gagttgctggcgaaaggctttactgtcctgaactataattcctattatctttacattgtt
ccgaaagcttcaccaaccttctcgcaagatgccgcctttgccgccaaagatgttataaaa
aattgggatcttggtgtttgggatggacgaaacaccaaaaaccgcgtacaaaatactcat
gaaatagccggcgcagcattatcgatctggggagaagatgcaaaagcgctgaaagacgaa
acaattcagaaaaacacgaaaagtttattggaagcggtgattcataagacgaatggggat
gagtga

DBGET integrated database retrieval system