KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1055Help
Entry
D11S_1055         CDS       T00993                                 

Definition
LacZ protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    D11S_1055
  Lipid metabolism
   00600 Sphingolipid metabolism
    D11S_1055
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D11S_1055
Enzymes [BR:aat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     D11S_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974943..975170
Genome map
AA seq 75 aa AA seqDB search
MENPREFYDYFMVLNGQFVGYSQISHCTSEFDVTNYLQLDENILDIIVLKWCDGSYLEEQ
DKFRMSGIFRDVYLL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatccaagagaattttacgattattttatggtgttgaacgggcaattcgtgggt
tatagccaaatcagccattgcacctctgaatttgatgtaacgaattatttacagttagac
gagaatatcctcgatattatcgtgctgaaatggtgtgacggcagttatttggaggaacag
gataaattccgtatgtcggggatttttcgtgatgtttatctgctgtaa

DBGET integrated database retrieval system