KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1083Help
Entry
D11S_1083         CDS       T00993                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997930..998613
Genome map
AA seq 227 aa AA seqDB search
MKKIITTLSLLAISMSVTANDVALKSKLEKLGVKDIDIQTSPIKGLKTVVSDQGIFYASE
DGEYLLQGKIYKLTDKGISNVTNKVLLDKLNALKNEMIVYPAKNEKHVITVFMDITCHYC
HLLHQQVKEYNDLGITVRYLAFPRAGMESQTAGQMEAIFTAKDPTFALNEAEKGNLPKEL
KTPNVVRKHYLLGAQFGVNGTPTIITSEGEVIGGYLKPADLLAALEG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattactacgctttctcttttggctatatctatgagtgtaacggcaaat
gatgttgcactgaaaagtaaattggaaaagcttggtgtgaaagatattgatattcaaact
tcaccgattaaaggcttgaaaactgtcgtaagcgaccaaggcattttttacgcaagtgaa
gacggcgaatatttattacaaggtaaaatctacaaattaaccgataaaggcattagcaac
gtcactaataaagtgttgctggataaattaaatgcgctgaaaaatgaaatgattgtgtat
ccggcaaaaaatgaaaaacacgtcattactgtatttatggatattacctgccattactgc
catttgttacatcaacaagtgaaagaatataacgacttaggcattaccgtacgttatttg
gcgttcccgcgtgcaggtatggagagtcaaactgcagggcaaatggaagcgatttttacc
gcaaaagacccaacattcgctttaaacgaagcggaaaaaggcaatcttccaaaagaattg
aagaccccgaatgtggtgagaaaacattatttgcttggcgctcaatttggtgtaaacgga
acgccgactatcattaccagtgaaggcgaagttattggtggttatctaaaacctgctgat
ttacttgcggcgttagaaggataa

DBGET integrated database retrieval system