KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1237Help
Entry
D11S_1237         CDS       T00993                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00010  Glycolysis / Gluconeogenesis
aat00020  Citrate cycle (TCA cycle)
aat00620  Pyruvate metabolism
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01120  Microbial metabolism in diverse environments
aat01130  Biosynthesis of antibiotics
aat01200  Carbon metabolism
Module
aat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_1237
   00020 Citrate cycle (TCA cycle)
    D11S_1237
   00620 Pyruvate metabolism
    D11S_1237
Enzymes [BR:aat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D11S_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACX82619
UniProt: C9R483
Position
1161062..1162675
Genome map
AA seq 537 aa AA seqDB search
MAKQIQIPDIGSDEVTVTEVMVNVGDSVTADQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVTTGTPMLVLDSADAASAQAPQAEAPAPQAAPAAAQVVDVNVPDIGGDEVNVTDVM
VKVGDRVEVDQSIINVEGDKASMEVPAPVAGIVKEIIIKAGDKVSTGTLIMRFETAGSAP
AAAPVASSPAAAPAPTEQAVPQAVPAPTAQASAPAAASSSQADVESAKSYAHATPVIRRL
AREFGVNLDKVKGTGRKGRILKEDIQAYVKAAVKALESGAAATGAANGAGLGLLPWPKVD
FSKFGEIEEVELSRINKISGANLHRNWVMIPHVTHFDKADITELEAFRKEQNVLSEKQKL
GVKITPVVFIMKAVAKALEAFPRFNSSITEDAQHLILKKYINVGVAVDTPNGLVVPVFKD
VNKKGIIELSRKLMEVSKKARDGKLTAADMQGGCFTISSLGGIGTTHFAPIVNAPEVAIL
GVSKSAMEPVWNGKEFAPRLILPISLSFDHRVIDGADGARFISYIGSVLADLRRLIM
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaattcaaatcccggatatcggtagtgatgaagttaccgtaaccgaagtg
atggtaaacgttggagatagcgtcaccgcggatcaatccattattaatgttgaaggtgat
aaagcttctatggaagtaccggcaccggaagcgggcgtggtaaaagaaattttagtaaaa
gtgggcgacaaagtgactaccggcacgccgatgttggtgttagatagtgccgatgccgca
tcggctcaagcgcctcaagctgaggcacctgcaccgcaagccgcgcctgctgccgcacaa
gtggtggatgttaatgtacctgacatcggcggtgacgaagtgaacgtgaccgatgtgatg
gtgaaagtgggtgatcgtgttgaagtggatcaatcgattattaatgttgaaggtgataag
gcttctatggaagtaccggcaccggtggcgggtatcgttaaagaaattattatcaaagcc
ggcgataaagtgtccacaggcactttaatcatgcgttttgaaacagcgggcagtgcgcct
gcagctgctccggtagcttcttcgcctgctgcagcgccggcaccgactgagcaagcagta
ccacaagctgtgcctgcaccgacagcacaggcttccgcgccggcagccgcatcttcttcc
caagcggatgttgaaagtgcgaaaagctatgcgcacgccacaccggtgattcgtcgttta
gcgcgcgaattcggtgtgaacctggataaagtgaaaggcacaggtcgtaagggtcgtatt
ttaaaagaagatattcaagcctatgtgaaagccgccgtgaaagctttggaaagcggtgct
gcggcaacaggcgctgcaaatggtgccggtttaggcttgttaccgtggccgaaagtggat
ttcagcaaattcggcgaaatcgaagaagtggaattaagtcgtatcaacaagatttccggt
gcgaacttacatcgtaactgggtcatgattccgcatgttacccatttcgataaagcggac
atcaccgagttggaagcattccgtaaagagcaaaacgtcttgtctgaaaaacaaaaactg
ggcgtgaaaatcacccctgtggtcttcattatgaaagccgttgccaaagcgttggaagcc
ttcccgcgtttcaacagttccattaccgaagatgcacaacatttgatcctgaaaaaatac
atcaatgtgggcgtggcggtagatacgccgaacggtttagttgtaccggtctttaaagat
gtcaacaaaaaaggcattatcgagctttcccgtaaattgatggaagtgtccaaaaaagcc
cgtgacggtaaattaaccgcagcggatatgcaaggcggttgtttcaccatttccagcctt
ggcggcattggtacaacacattttgcaccaatcgtgaatgcacctgaagtggcgattttg
ggtgtctccaaatccgctatggaaccggtttggaacggtaaagaatttgcgccgcgcttg
attctgccgatttccttatcttttgaccaccgtgttattgacggtgcggacggtgcacgc
ttcatcagctacatcggttccgtattagccgacttacgtcgtttaattatgtaa

DBGET integrated database retrieval system