KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1291Help
Entry
D11S_1291         CDS       T00993                                 

Definition
phosphoglycerate mutase family protein
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D11S_1291
   01230 Biosynthesis of amino acids
    D11S_1291
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_1291
  Energy metabolism
   00680 Methane metabolism
    D11S_1291
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D11S_1291
Enzymes [BR:aat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     D11S_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210315..1210956)
Genome map
AA seq 213 aa AA seqDB search
MNKNLTFYLIRHGRTLWNEQGLLQGFGNSALTESGVKGAQLTGMALKDTPFVAAYTSCLQ
RTIDTAQHILGERNVPLFQHYGLNEQYFGTWEGLPVDELRHLEEFQQMRSDAANYKAQSN
NGETFEQLAERAMKAIQDIIQVHDQGNILIISHGHTLRLLLSLFNGVTWQEHRNEGKSQT
LLNTSINIVRYRQTNADDGKFTLEVINETGHLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaatctgactttttatttaatccgccacggtcgtaccctttggaacgaacag
ggtttattgcaaggcttcggcaattccgcattaacggaaagcggcgtcaaaggcgcacag
cttaccggcatggcattaaaagacacacctttcgtagcggcttataccagctgcctacaa
cgcactatcgacacggcgcaacatatcttgggcgagcgaaatgtgccgctatttcaacat
tatggtttaaatgaacaatatttcggcacctgggaaggcttgcccgttgacgaactacgc
catttggaagaattccaacaaatgcgcagcgacgcggcaaattacaaagcgcaaagcaat
aacggcgagacctttgagcaattagccgaacgggcaatgaaagccatacaggatattatt
caggtgcatgatcagggaaatattctgattatttcccacgggcacacgctccgcttgctt
ttatctcttttcaacggggtaacctggcaggaacaccgtaacgagggcaaaagccagacc
ttgctgaatacctcgattaatatcgtgcgttaccgacaaaccaacgccgacgacggtaag
tttacccttgaagtgatcaatgaaacgggacatttaagttaa

DBGET integrated database retrieval system