KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1309Help
Entry
D11S_1309         CDS       T00993                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D11S_1309
Enzymes [BR:aat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     D11S_1309
Exosome [BR:aat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D11S_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1228186..1230381
Genome map
AA seq 731 aa AA seqDB search
MTQLVAQSVINQFFDGTHGDPFSVLGMHETEKGIEIRALLPDASRVLVIEKENQETLCEL
THLDDRGFFAGVVPDTRNFFAYQLQVYWGKESQIIEDPYRYHPMINDLDEWLLAEGSFLR
PYEVLGAHFIECDGVSGVNFRLWAPNAKRVSVVGDFNYWDGRRHPMRLHPASGVWELFLP
KVSLGQLYKFELIDCHGNLRLKADPYAFSSQLRPDTASQISLLPSVVPMTEARRKANQWD
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVQEMGFTHIEFLPLSEFPFDGSWGY
QPLGLYSPTSRFGTPEGFKRLVERAHDAGINVILDWVPGHFPSDTHGLVAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVKNFLSSNALYWLERFGIDGIRVDAVASMIYRDYSRAEG
QWIPNQYGGRENLEAIEFLKHTNWKIHSEVPGSIAIAEESTAFTGVTHPSEQGGLGFNFK
WNMGWMNDTLSYMEKDPVYRQYHHNQMTFGMMYQYSENFVLPLSHDEVVHGKCSLIGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYRESLDWFLLDEGIGGQWHIG
VQQLVKDLNKIYRENAPLFELDSDPQGFDWLVADDAQNSVFAFERRSRDGGRILVISNLT
PVPRHDYRLGVNVAGEYHEILNTDSAYYAGSNVGNLGAVHSEDIASHNRANSISVSIPPL
ATIYLKYQGKA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattagtagcgcaatcagttatcaatcaattttttgacggcacacatggtgat
ccgttttccgtattgggtatgcacgaaaccgaaaagggtattgaaattcgtgcgttgttg
ccggatgcaagtcgtgttttggtcattgaaaaagaaaatcaggaaacgttgtgtgaatta
acccatttagatgacagaggcttttttgccggcgtggtgccggatacgcggaatttcttt
gcttatcaactacaggtgtattggggtaaagagtcacaaattattgaagacccgtaccgt
tatcacccgatgattaatgatttggatgaatggttgttggcggaaggttcgtttttacgt
ccgtatgaagtattaggcgcgcatttcattgaatgtgacggtgtctcaggcgtgaatttc
cgtttgtgggcgccaaatgccaaacgggtttctgtggtaggcgattttaactattgggac
ggtcgtcgccatccaatgcgcttacacccggcaagcggcgtgtgggaattgttcctgccg
aaagtctctttggggcaactgtataaatttgaattaatcgattgccatggcaacctccgc
ttaaaagccgacccttatgccttcagttctcagttacgtcccgataccgcgtcacaaatc
agtctgttgccgagtgtcgtgccgatgacggaagcccgtcgtaaagctaaccaatgggat
cagccgatttccatttatgaggtgcatttaggctcttggcgacgtaacttggaaaacaat
ttctggctggattacgatcaaatcgccgacgaattgattccttacgtgcaggaaatgggc
ttcacccatattgaatttttaccgttgtccgagtttccgtttgacggttcttggggttat
caaccgcttggcttgtattcgccgaccagccgttttggtacgccggaaggctttaaacgc
ttggtagagcgggcgcatgatgccggtattaatgtgattctcgactgggtgccggggcat
ttcccgagcgatacccacggtttggtggcatttgacggtacggcattgtatgagcacgcc
gatccgcgcgaaggctatcaccaagattggaatacgctgatttacaactacggacgcaac
gaagttaagaatttcttatccagtaatgcgttgtattggcttgaacgcttcggtatcgac
ggcattcgggtcgatgcggtggcgtctatgatttatcgtgattacagtcgcgccgaaggg
cagtggattccgaatcaatacggcgggcgggaaaacttagaagccattgaatttttgaaa
cataccaactggaaaatccatagcgaagtaccgggttctatcgccattgcggaagaatcc
accgcctttaccggcgtgacccatccgagcgaacagggcggtttaggttttaatttcaag
tggaacatgggttggatgaacgacaccttatcctacatggaaaaagaccccgtttatcgc
caatatcaccacaaccaaatgactttcggcatgatgtatcaatacagcgaaaacttcgtg
ttgccgctttctcatgacgaagtggtgcatggcaaatgttctcttatcggcaaaatgccg
ggcgatgcgtggcaaaaatttgccaatttgcgtgcctattatggctatatgtggggttat
ccgggcaaaaaattgctatttatgggcaatgaattcgcccaaggtcgcgaatggaattac
cgtgaaagtctggattggttcctgctagatgaaggcatcggcggtcaatggcatatcggc
gtacaacagctggtgaaagatctcaataaaatttaccgcgaaaacgcaccgctctttgag
ctggattccgatcctcagggctttgattggttggtggcagatgacgcacaaaattccgtt
ttcgcttttgaacgccgcagccgtgatggcggacgtattcttgtaatcagcaacctcacg
ccggtgccgcgtcatgattatcgtctcggtgtgaatgttgccggcgaatatcacgaaatt
ttaaataccgactccgcctattacgccggttcaaatgtgggtaatttaggcgctgtacac
agcgaagacatcgccagccataatcgggcgaactccatttccgtctctattccgccattg
gcaaccatttatttgaaatatcagggtaaagcatga

DBGET integrated database retrieval system