KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1387Help
Entry
D11S_1387         CDS       T00993                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00260  Glycine, serine and threonine metabolism
aat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01130  Biosynthesis of antibiotics
aat01230  Biosynthesis of amino acids
Module
aat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D11S_1387
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D11S_1387
Enzymes [BR:aat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     D11S_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACX82769
UniProt: C9R4N3
Position
1312019..1312825
Genome map
AA seq 268 aa AA seqDB search
MSRFETTFAQLHAQNEGAFVPFVTLCDPTFDRSFDIICTLVDNEADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLEKVRSKYPEIPMSLLLCANLIFAKGLDNFYQRCAD
VGVDAVLVADIPLLAKDDYVAAAKRHGIQPVFICPPNADEKTIQDVAQNSEGYTYLVSRA
GVTGAENQSHTANLDSLVERLKAHHAAPILQGFGIAQPAQVKEALQLGAAEAISGSATVK
IIARNLDNHAQCLTELGEFVRNMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaaccacatttgcccaattacacgcgcaaaatgaaggcgcattcgtt
cctttcgtgaccttatgcgacccgactttcgaccgttcttttgacattatttgcaccctg
gtggataacgaggcggacgcattggaactgggttttccgttctccgatcccttattggac
ggaccggtgattcaagccgccaacaatcgtgcgttaaacgccggtcacagcacggaagac
agctttaaattgctggaaaaagtgcggtcaaaatatccggagattccgatgagtttgctg
ctttgcgccaatttaatttttgccaaaggcttggataatttttatcagcgttgcgccgac
gtgggcgtggacgccgtgttggttgccgatattccgttgttggcgaaagacgattatgtc
gccgccgcgaaaagacacggtattcaacccgtttttatttgcccgccgaatgcagacgaa
aaaaccattcaagatgtggcgcaaaatagtgaaggttacacgtatttggtttcccgcgcg
ggcgtgaccggtgcagaaaatcaaagccatacggcgaatctggacagcttagtagaacga
ctcaaagcccaccacgccgcgccaattctgcaaggcttcggcatcgcccaaccggcgcag
gtaaaagaagcactgcaactgggcgcggcagaggcgatttccggttccgctacggtgaaa
atcattgcgcgaaatttggataaccacgcccaatgtttaactgaactcggcgaattcgta
cgcaatatgaaagcggcgacgaaataa

DBGET integrated database retrieval system