KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1500Help
Entry
D11S_1500         CDS       T00993                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D11S_1500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D11S_1500
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    D11S_1500
Enzymes [BR:aat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     D11S_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425460..1426734
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPQNIPHLTNIDELLALPLIERSQKILGAL
IGEEIPPAQLEQVVRNAFTFPAPVVKVEDNIYALELFHGPTLAFKDFGGRFMAQALATVR
GDGKITILTATSGDTGAAVAHAFYGLDNIEVVILYPKGKISPLQEKLFCTFGGNIRTVAI
NADFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAAAQLPKKQRENLV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYLHSGNWSPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALTELHSAAISDGQTEETLRAMHKLGYLCEPHGAVAYEVLK
QDLQTGETGLFLCTAHPAKFKESVERILDLTLPLPEALDKHNKLPLLSDEMENDFAQLRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacatcaaacaccccgaagaacaagtcaatttcgctcaagcagtgcgc
caagggttaggcaaagatcaaggcttatttttcccgcaaaacataccgcacttaacgaat
atcgacgaactattggcattgccgttgattgaacgcagccaaaaaattctcggtgcgtta
atcggtgaagaaatcccgccggcacagcttgaacaagtggtgcgcaacgccttcaccttc
cccgcgccggtggtgaaagtggaagacaatatttatgcgctagaattattccacggaccg
acactcgcctttaaagatttcggcggacgcttcatggcgcaagctttagccaccgtacgc
ggtgatggcaaaatcaccattttaaccgccacttccggcgacaccggcgcggcggtagcg
catgccttctacggtttagacaatattgaagtggtgattttatatccgaaaggcaaaatc
agcccgttacaggaaaaactcttctgcacctttggcggcaatattcgcaccgtcgctatc
aacgccgatttcgacgcctgccaagcgttagtgaaacaagcctttgatgacgccgaattg
cgccaagccatcggtttaaactccgccaactccatcaatatcagccgtttattggcgcaa
gtgtgctattactttgaagcggcagcgcaattaccgaaaaaacagcgtgaaaatctcgta
gtctccgtgccaagcggcaacttcggcaacctcaccgccggcttaatcgccaaaaccctt
ggcttgccgatcaaacgctttatcgccgccaccaacgcaaacgacaccgtgccgcgctat
ttacacagcggcaattggtcaccgaacgccaccgttgccaccctttccaacgccatggac
gtttcccgcccgaataactggccgcgcgtggaagaattgttcaaacgtaacggctgggcg
ttaaccgaattacattcggcggcaatttccgatgggcaaacggaagaaacattacgcgca
atgcacaaactcggctatttatgcgagccacatggtgcggtggcgtatgaggtgcttaaa
caggatttacaaacgggtgaaaccggtttattcctttgcaccgcccacccggcgaaattc
aaggaatccgttgagcgcattctggatttaaccctgccattgccggaagccttggataaa
cataacaaactgccgttgttatccgatgaaatggaaaacgattttgcgcagttaagagct
tatttattgaaataa

DBGET integrated database retrieval system