KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1753Help
Entry
D11S_1753         CDS       T00993                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D11S_1753
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D11S_1753
  Amino acid metabolism
   00310 Lysine degradation
    D11S_1753
Enzymes [BR:aat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     D11S_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1681521..1682744)
Genome map
AA seq 407 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGYAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL
QEEGATVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHVTDAQGPAVRRLL
AEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAEDTLSTVAYAARSEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKFEKQHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDNLSMADIEKS
IKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVAL
NGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaattcttgtccccgatttacccgaatccgtagccgatgccaccgtggca
acttggcacaaaaaagcgggctacgcagtgaaacgtgatgaagtgattgtggaaatcgag
accgacaaagtggtgcttgaagtgccggcacaggcggacggcgtgcttgcccagattttg
caggaagaaggggcaacagtagtcagcaaacagttgcttggcactctggaagattcggtg
acggcggcagccattgcaacggaaaaaacggcggagccgacaccgaaagatcgtcgcacg
gaagtgcctgatgaaccgcatgtcaccgatgcgcaaggacctgcggtacgccgtttatta
gccgagcacggtttacagccttccgatgttgccgatgtaaaaggcaccggcgtgggcggc
agaattacccgtgaagatgtggaagcgatccttgcccaacgcacggctgcagcggcacaa
ccgcaagtggcggaagataccctcagcaccgtggcatatgccgcacgtagtgaaaaacgc
gtgccgatgacccgtttacgcaaacgtattgcggaacgtctgttggaagccaaaaacacc
accgcgatgttgactacgttcaatgaagtggatatgcagccgatcatgaacctgcgtaaa
caatacggtgaaaaatttgaaaaacaacacggcgtgcgtttaggcttcatgtctttttat
atcaaagccgtggtggaagccttaaaacgttatccggaagtgaatgcctccattgacggc
gacgatgtgatttatcacaactattttgacgtgagcattgcggtttcgactccacgcggt
ttagtgacgccggtattgcgcgattgtgataatctttccatggcggacattgaaaaatct
atcaaagccctggcggaaaaagggcgtgacggcaaattgacagtagaagatttaaccggc
ggtaacttcaccattaccaacggcggcgtgtttggttcgctaatgtccactccgattatc
aacccgccgcaaagtgccattttaggtatgcacgccattaaagaacgcccggtggcgcta
aacggtcaagtggtgattcgcccgatgatgtatttggcattgagttacgaccaccgctta
attgacgggcgggaatccgtcggtttcttagtgacgataaaagagctgctggaagacccg
acaagattattacttgaaatttaa

DBGET integrated database retrieval system