KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1953Help
Entry
D11S_1953         CDS       T00993                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D11S_1953
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    D11S_1953
Enzymes [BR:aat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D11S_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879677..1880723
Genome map
AA seq 348 aa AA seqDB search
MSTLLIDLAGYELQQEEIELLEHPLVAGLILFTRNFHDRAQLQALIRSVRQKVKKPLLIT
VDQEGGRVQRFREGFTQIPAMQAFSALIKDPAQQQKMAQEAGWQMAAEMTALDIDLSFAP
VLDLGHQCKAIGDRSFGDDVKSAVDLAANFIRGMHQAGMAATGKHFPGHGHVIADSHLET
PYDERSKDEIFRQDIQPFQQLIEQHLLQAIMPAHVIYSQCDNQPASGSAYWLQDVLRHQL
HFNGAIFSDDLGMKGAGFMGDFVARSEQALNAGCDLLLLCNERDGVIQVLDQLKLTEKQP
HFLLRQQRLRRLFKRKSFTWSELESAPRWLENREKLTALQQQWLATKG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattactcattgacttagccggttacgaacttcaacaggaagaaatcgaactg
ctggaacacccgctggtggcgggtttaattctcttcacccgcaactttcacgatcgcgcg
caacttcaagcgcttatccgatccgtacgacaaaaagtgaaaaaaccgttgctgattacc
gtggatcaggaaggcggtcgggtacagcgttttcgtgaaggcttcactcaaattcccgcc
atgcaggcgttttccgcgctgattaaagatccggcgcaacaacagaaaatggcgcaggaa
gccggctggcaaatggcggcagaaatgaccgcacttgatattgatctgagcttcgcgccg
gtgctggatctcggtcaccaatgcaaagccatcggcgatcgcagtttcggtgacgacgtc
aaaagtgcggtggatttggcagccaattttattcgcggcatgcaccaggcaggcatggcg
gcaacgggcaaacactttcccgggcatgggcacgttatcgccgattcccatttggaaacg
ccttatgacgaacgaagcaaagacgagattttccggcaagacattcaaccgtttcaacaa
ctcattgaacaacaccttctgcaagccatcatgcccgctcatgtgatttactcgcaatgc
gataaccaaccggcgagcggttccgcctattggctgcaagatgttttacgccatcagctg
cattttaacggtgccattttctccgacgatctcggcatgaaaggcgccggatttatgggc
gattttgtagctcgcagtgaacaggcactgaatgcgggctgcgatttattattgctttgc
aacgaacgggacggcgtgattcaagtgttggaccagttaaaactcacggaaaaacaaccg
cactttttgctacgccaacagcgcttacgacgcctcttcaaacgtaaaagtttcacttgg
tcagagctggaatccgcgccacgttggttggaaaatcgcgaaaaactgaccgcacttcaa
cagcaatggctggcaaccaaaggttaa

DBGET integrated database retrieval system