KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1953Help
Entry
D11S_1953         CDS       T00993                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aat00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:aat00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879677..1880723
Genome map
AA seq 348 aa AA seqDB search
MSTLLIDLAGYELQQEEIELLEHPLVAGLILFTRNFHDRAQLQALIRSVRQKVKKPLLIT
VDQEGGRVQRFREGFTQIPAMQAFSALIKDPAQQQKMAQEAGWQMAAEMTALDIDLSFAP
VLDLGHQCKAIGDRSFGDDVKSAVDLAANFIRGMHQAGMAATGKHFPGHGHVIADSHLET
PYDERSKDEIFRQDIQPFQQLIEQHLLQAIMPAHVIYSQCDNQPASGSAYWLQDVLRHQL
HFNGAIFSDDLGMKGAGFMGDFVARSEQALNAGCDLLLLCNERDGVIQVLDQLKLTEKQP
HFLLRQQRLRRLFKRKSFTWSELESAPRWLENREKLTALQQQWLATKG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattactcattgacttagccggttacgaacttcaacaggaagaaatcgaactg
ctggaacacccgctggtggcgggtttaattctcttcacccgcaactttcacgatcgcgcg
caacttcaagcgcttatccgatccgtacgacaaaaagtgaaaaaaccgttgctgattacc
gtggatcaggaaggcggtcgggtacagcgttttcgtgaaggcttcactcaaattcccgcc
atgcaggcgttttccgcgctgattaaagatccggcgcaacaacagaaaatggcgcaggaa
gccggctggcaaatggcggcagaaatgaccgcacttgatattgatctgagcttcgcgccg
gtgctggatctcggtcaccaatgcaaagccatcggcgatcgcagtttcggtgacgacgtc
aaaagtgcggtggatttggcagccaattttattcgcggcatgcaccaggcaggcatggcg
gcaacgggcaaacactttcccgggcatgggcacgttatcgccgattcccatttggaaacg
ccttatgacgaacgaagcaaagacgagattttccggcaagacattcaaccgtttcaacaa
ctcattgaacaacaccttctgcaagccatcatgcccgctcatgtgatttactcgcaatgc
gataaccaaccggcgagcggttccgcctattggctgcaagatgttttacgccatcagctg
cattttaacggtgccattttctccgacgatctcggcatgaaaggcgccggatttatgggc
gattttgtagctcgcagtgaacaggcactgaatgcgggctgcgatttattattgctttgc
aacgaacgggacggcgtgattcaagtgttggaccagttaaaactcacggaaaaacaaccg
cactttttgctacgccaacagcgcttacgacgcctcttcaaacgtaaaagtttcacttgg
tcagagctggaatccgcgccacgttggttggaaaatcgcgaaaaactgaccgcacttcaa
cagcaatggctggcaaccaaaggttaa

DBGET integrated database retrieval system