KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1956Help
Entry
D11S_1956         CDS       T00993                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D11S_1956
   01230 Biosynthesis of amino acids
    D11S_1956
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_1956
   00030 Pentose phosphate pathway
    D11S_1956
   00051 Fructose and mannose metabolism
    D11S_1956
   00052 Galactose metabolism
    D11S_1956
  Energy metabolism
   00680 Methane metabolism
    D11S_1956
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    D11S_1956
Enzymes [BR:aat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     D11S_1956
Protein phosphatases and associated proteins [BR:aat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     D11S_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1882002..1882967)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVYGIYDGYHGLYNNKIKQLTRYSVSD
IINRGGTFLGSARFPEFKNPDVRAKCAEILRSHGISALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIRQIERSIIKGKRHAIIAITELICDVNELAREIEARV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLNMSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagtattaacaagtggtggcgatgccccgggtatgaacgccgca
attcgcggtgtggtccgttcagcattagccgaagggttggaagtgtatggtatttacgac
gggtatcatggtttatataacaataaaatcaaacaattaacccgttatagtgtgtccgat
attatcaatcgcggcggtacattcttagggtctgcccgtttccctgaatttaaaaatcct
gacgtgcgggcaaaatgtgcggagattttacgctctcacggcattagtgctttggtagtt
atcggcggtgacggttcctacatgggcgcaaaattattaacggaagaacatggtttccct
tgcgtcggtatcccgggcactatcgataacgacgttgccggcaccgactataccatcggc
taccaaaccgcccttgaaactgccgttgaggccatcgatcgcttacgcgacacctcaagt
tcccatcaacgcatctctatcgtcgaaatcatggggcgccattgtagcgatctcactatc
tccgcagggattgccggcggttgcgaatacatcgtggcgtcagaaatcgaatttaatcgt
gaagagttaattcgccaaatcgaaagaagcattatcaaaggcaaacgccacgcgattatc
gctattaccgagcttatttgcgacgtaaacgagttagcgcgcgaaattgaagcccgcgtg
aaacacgaaacccgcgccactattttgggtcatattcaacgtggcggcacaccttgtgct
ttcgaccgtattttaggttcgcgcatgggggtttatgccgttgatttgctgttacaaggc
aaaggcggctactgcgtgggtatccaaaacgaacaattggttcaccatgacatcatcgat
gcgatcaacaatatgcgccgtgaattcaaagccgattggttgaatatgtccaaacgtttg
gattaa

DBGET integrated database retrieval system