KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1956Help
Entry
D11S_1956         CDS       T00993                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00010  Glycolysis / Gluconeogenesis
aat00030  Pentose phosphate pathway
aat00051  Fructose and mannose metabolism
aat00052  Galactose metabolism
aat00680  Methane metabolism
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01120  Microbial metabolism in diverse environments
aat01130  Biosynthesis of antibiotics
aat01200  Carbon metabolism
aat01230  Biosynthesis of amino acids
aat03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_1956
   00030 Pentose phosphate pathway
    D11S_1956
   00051 Fructose and mannose metabolism
    D11S_1956
   00052 Galactose metabolism
    D11S_1956
  Energy metabolism
   00680 Methane metabolism
    D11S_1956
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    D11S_1956
Enzymes [BR:aat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     D11S_1956
Protein phosphatases and associated proteins [BR:aat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     D11S_1956
Messenger RNA biogenesis [BR:aat03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     D11S_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACX83310
UniProt: C9R674
Position
complement(1882029..1882994)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVYGIYDGYHGLYNNKIKQLTRYSVSD
IINRGGTFLGSARFPEFKNPDVRAKCAEILRSHGISALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIRQIERSIIKGKRHAIIAITELICDVNELAREIEARV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLNMSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagtattaacaagtggtggcgatgccccgggtatgaacgccgca
attcgcggtgtggtccgttcagcattagccgaagggttggaagtgtatggtatttacgac
gggtatcatggtttatataacaataaaatcaaacaattaacccgttatagtgtgtccgat
attatcaatcgcggcggtacattcttagggtctgcccgtttccctgaatttaaaaatcct
gacgtgcgggcaaaatgtgcggagattttacgctctcacggcattagtgctttggtagtt
atcggcggtgacggttcctacatgggcgcaaaattattaacggaagaacatggtttccct
tgcgtcggtatcccgggcactatcgataacgacgttgccggcaccgactataccatcggc
taccaaaccgcccttgaaactgccgttgaggccatcgatcgcttacgcgacacctcaagt
tcccatcaacgcatctctatcgtcgaaatcatggggcgccattgtagcgatctcactatc
tccgcagggattgccggcggttgcgaatacatcgtggcgtcagaaatcgaatttaatcgt
gaagagttaattcgccaaatcgaaagaagcattatcaaaggcaaacgccacgcgattatc
gctattaccgagcttatttgcgacgtaaacgagttagcgcgcgaaattgaagcccgcgtg
aaacacgaaacccgcgccactattttgggtcatattcaacgtggcggcacaccttgtgct
ttcgaccgtattttaggttcgcgcatgggggtttatgccgttgatttgctgttacaaggc
aaaggcggctactgcgtgggtatccaaaacgaacaattggttcaccatgacatcatcgat
gcgatcaacaatatgcgccgtgaattcaaagccgattggttgaatatgtccaaacgtttg
gattaa

DBGET integrated database retrieval system