KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_2097Help
Entry
D11S_2097         CDS       T00993                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00010  Glycolysis / Gluconeogenesis
aat00051  Fructose and mannose metabolism
aat00562  Inositol phosphate metabolism
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01120  Microbial metabolism in diverse environments
aat01130  Biosynthesis of antibiotics
aat01200  Carbon metabolism
aat01230  Biosynthesis of amino acids
Module
aat_M00002  Glycolysis, core module involving three-carbon compounds
aat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_2097
   00051 Fructose and mannose metabolism
    D11S_2097
   00562 Inositol phosphate metabolism
    D11S_2097
Enzymes [BR:aat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     D11S_2097
Exosome [BR:aat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   D11S_2097
  Exosomal proteins of bladder cancer cells
   D11S_2097
  Exosomal proteins of melanoma cells
   D11S_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACX83451
UniProt: C9R6L5
Position
complement(2011362..2012129)
Genome map
AA seq 255 aa AA seqDB search
MVCRPLVMGNWKLNGSKAFTRELITGLKEELHGVTGCNVAIAPPVMYLAEAEAALVGSQI
VLGAQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAKKFGALKEA
GLVPVLCIGESEAENEAGKTEEVCARQIDAVINLLGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAKKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKA
PAFAVIVKAAAKEKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcgttcacc
agagaattaattaccggtttgaaggaagaattgcatggtgtgaccggttgtaatgtggca
attgctccaccggtgatgtatttggcggaagcggaagccgcgctggttggcagtcaaatt
gttttaggtgcacaaaacgttgatgtgaacgtgaaaggcgcattcaccggcgatatttct
accgaaatgttaaaagatttcggcgcgaaatatatcattattggtcactccgaacgtcgt
acttatcataaagaaagcgatgaattcgtggcgaaaaaattcggtgcgttaaaagaagcg
ggcttggtgccggtgttatgtatcggtgaatccgaagcggaaaacgaagcaggaaaaacc
gaagaagtgtgcgcccgtcaaattgacgcggtgattaacctgttaggcgtggaagccttc
aatggcgcggtgattgcctacgaaccgatttgggcaatcggcaccggcaaatctgccact
ccggcgcaagcgcaagcggtacacgcgttcattcgcggtcatatcgcgaaaaaatcccaa
gcggttgccgaccaagtgattattcaatacggcggttccgtaaacgatgccaacgcggcg
gaattgttcacccaaccggatattgacggtgcattggtgggcggcgcatccttaaaagcc
ccggcatttgcggttatcgtaaaagcagcggcaaaagagaaaaactaa

DBGET integrated database retrieval system