KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_2097Help
Entry
D11S_2097         CDS       T00993                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D11S_2097 (tpiA)
   01230 Biosynthesis of amino acids
    D11S_2097 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_2097 (tpiA)
   00051 Fructose and mannose metabolism
    D11S_2097 (tpiA)
   00562 Inositol phosphate metabolism
    D11S_2097 (tpiA)
Enzymes [BR:aat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     D11S_2097 (tpiA)
Exosome [BR:aat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   D11S_2097 (tpiA)
  Exosomal proteins of bladder cancer cells
   D11S_2097 (tpiA)
  Exosomal proteins of melanoma cells
   D11S_2097 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2011335..2012102)
Genome map
AA seq 255 aa AA seqDB search
MVCRPLVMGNWKLNGSKAFTRELITGLKEELHGVTGCNVAIAPPVMYLAEAEAALVGSQI
VLGAQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAKKFGALKEA
GLVPVLCIGESEAENEAGKTEEVCARQIDAVINLLGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAKKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKA
PAFAVIVKAAAKEKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcgttcacc
agagaattaattaccggtttgaaggaagaattgcatggtgtgaccggttgtaatgtggca
attgctccaccggtgatgtatttggcggaagcggaagccgcgctggttggcagtcaaatt
gttttaggtgcacaaaacgttgatgtgaacgtgaaaggcgcattcaccggcgatatttct
accgaaatgttaaaagatttcggcgcgaaatatatcattattggtcactccgaacgtcgt
acttatcataaagaaagcgatgaattcgtggcgaaaaaattcggtgcgttaaaagaagcg
ggcttggtgccggtgttatgtatcggtgaatccgaagcggaaaacgaagcaggaaaaacc
gaagaagtgtgcgcccgtcaaattgacgcggtgattaacctgttaggcgtggaagccttc
aatggcgcggtgattgcctacgaaccgatttgggcaatcggcaccggcaaatctgccact
ccggcgcaagcgcaagcggtacacgcgttcattcgcggtcatatcgcgaaaaaatcccaa
gcggttgccgaccaagtgattattcaatacggcggttccgtaaacgatgccaacgcggcg
gaattgttcacccaaccggatattgacggtgcattggtgggcggcgcatccttaaaagcc
ccggcatttgcggttatcgtaaaagcagcggcaaaagagaaaaactaa

DBGET integrated database retrieval system