KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_2111Help
Entry
D11S_2111         CDS       T00993                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D11S_2111
Enzymes [BR:aat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     D11S_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2023297..2024229
Genome map
AA seq 310 aa AA seqDB search
MCAKLVVLGSVNADHMIRVPRFARAGETLRGSGYRIAYGGKGANQAVAAARLKDPNTQVD
FIACLGNDDIGRTMKAAFAKDGINTATITQVEQEMTGVAMIQVADNGENSIVINAGANAC
LDEHLVSCYAAHIQQADALLMQLETPLSAICKAAQIAKQNGTKVILNPAPAQALPEELLR
QLYMITPNETEAEILTDIKVEDKISAAQAAKRFHQLGVQIVLITLGAKGVYFSENGQGQI
IGGFRVKAKDTTAAGDTFNGALAVALLEGKTLTNAIRFAHAAAAISVTREGAQPSIPSRA
EALDFLEKQG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctaaactcgttgtgctcggcagcgttaacgccgatcatatgattcgtgtcccg
cgttttgctcgcgccggtgaaacgttacgcggctccggttaccgcattgcttacggcggc
aaaggtgctaatcaggcggtagctgccgcacggttaaaagatccaaacacgcaggtggat
tttatcgcctgccttggtaacgatgacataggtcgtaccatgaaagccgcttttgcaaaa
gacggcattaacacggcgaccataactcaagttgagcaggaaatgacgggggtcgctatg
attcaagtggcggacaacggcgaaaacagcattgtaattaacgccggtgccaatgcctgt
ctggacgaacatctcgtttcctgttatgccgcgcatattcaacaagcggatgccttgtta
atgcagctggaaacccctctttcggcaatttgtaaagcggcgcaaatcgccaaacaaaac
ggtacaaaagtgattcttaatcctgcgccggcgcaagcattaccggaagaattgctccgg
cagttatatatgattacaccaaatgaaacggaagcggaaatcctgacggacattaaagtg
gaagataaaatctcggcagcacaggcggcaaaaagattccatcaactaggcgtgcaaatc
gtgcttattaccctgggtgccaaaggggtttatttcagtgaaaatggtcaggggcaaatt
atcggcggttttcgcgtaaaagcgaaagacaccacggcagcaggcgataccttcaatggt
gccttggcggttgcgttactggaaggaaaaacattgacgaatgccattcgcttcgcccac
gcagcggcggcaatcagcgtcacccgcgaaggtgcgcagccctcaattccgagccgtgcg
gaagccttggattttcttgaaaagcagggataa

DBGET integrated database retrieval system