KEGG   Arthrobacter aurescens: AAur_0140Help
Entry
AAur_0140         CDS       T00447                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aau  Arthrobacter aurescens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
141998..142903
Genome map
AA seq 301 aa AA seqDB search
MDSLAAAPGTGPATSPLPILRKPRPAARFEDLPTDRTLVMGILNVTPDSFSDGGTHRTPD
TAIALGLRMFYAGADIIDVGGESTRSGAEPVSPEEEQRRVLPVIQALVKAGALVSIDTMH
TSTAAAAIEAGAAIINDVSGLTIEPDMPELVARTKVPYILTHRRGDALTMDSLTDYNNVT
EDVVAEISGVRDKLYAAGVAPEQIIIDPGVGFSKNEDQNWEILKNLDQLFSLGHKVMVAA
SRKRFLGSLLTVAGKSAAPLERDAATAAITALSATKGAWAVRVHDVGPSLDAVKVAARIS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggactccctcgctgcagcacccggaaccggcccggccacaagcccgttgccgattctc
cgcaaaccgcgccccgcggccaggttcgaggacctgccaacggaccgcacgctcgtcatg
ggaatcctcaatgtcaccccggattccttcagcgacggtggcacgcaccggacaccggac
accgccatcgcgctcggcctgcgcatgttttacgcaggcgcagacatcatcgacgtcggg
ggtgagtccactcgctctggcgctgaaccggtttcccctgaggaagaacagcgccgcgtc
ctccccgtgatccaggcactggtgaaggcaggagcgctggtcagcattgacacaatgcac
acgtccacggctgccgctgccatcgaggcaggcgctgccatcatcaacgatgtttccggc
ctgacgattgaaccggatatgcccgagctcgttgcccggaccaaggttccgtacatcctg
actcatcgccgcggcgacgccctgaccatggacagcctcacggactacaacaacgtcacg
gaggacgtggtggctgagatcagcggcgtccgcgacaagctgtacgcagctggcgttgcg
ccggagcagatcatcatcgatcccggcgtcggtttctccaagaacgaggaccagaactgg
gagatcctcaagaacctggaccagcttttctcgctgggccacaaggtgatggttgcggct
tcccgcaaacggttcctcggttcgcttctcacggtggcaggcaagtccgctgcgcctctg
gaacgcgatgctgccaccgctgccattaccgctttgagcgccactaagggcgcttgggct
gtccgcgttcacgacgtcggccccagccttgacgccgtcaaggtcgccgcccgcatttcc
cgctga

DBGET integrated database retrieval system