KEGG   Arthrobacter aurescens: AAur_0237Help
Entry
AAur_0237         CDS       T00447                                 

Definition
pectinesterase/pectate lyase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
aau  Arthrobacter aurescens
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AAur_0237
   00500 Starch and sucrose metabolism
    AAur_0237
Enzymes [BR:aau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AAur_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240298..242280)
Genome map
AA seq 660 aa AA seqDB search
MRLRRLLGAATAVVILGSLTAVPARAEPIHSGTESPAAPAALWKQRPDGFASLPGNGLDG
TTGGQAGRHVSVSSLEELKTHAAAEEPLVIFLKGSITAQDYVKIPVASNKSFIGTGAGVE
LINAGFKLINVSNVIFRNFTVRDSYIPGDWDGKRPDNDRDGIQLDTSHHVWVDHMKFERM
GDGMIDTRKDSDYLTYSWNVFADNNKALGVGWTGNAVTKMTIHHNWIRNTVQRNFSLDNT
AAAHVYNNYLQDIGQYGMMGRNAAKVVLEGNYFTAVADPVVAKDPATEIVNRDNIFESTR
GRKDNVGSAFDPTQFYSYAKDDSARVPELVTGSAGPRENKAPSTTAEVTVALDGTGDFGS
VQAAIGSIPVGNTQPRTITIKPGFYREAVNVWADRPNVTLQGATANPADVVISYDTPANG
AKFFGGTWGAAGSATLNVLAENTTVRNLTVENAYDEAVHGGSQALAVRTVADKITFDNTR
FLGNQDTYLADTTGRDATARTYLKNCYIEGDVDFLYGRGTAVFDGCTIHSLDRGSDTNNG
YIVAPSTKDSNPYGFLIVDSTLTSDAAPGTVSLGRPWFASSDPNAHPMAVIRDSNLGSHI
AEQGWSDMSGHAWTEGRFAEFNNTGPGAYINEFHPQLTPEEGLKFTKDTFLGDWTPAAGA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgacgcctactcggcgcggccaccgccgtcgtcattcttggaagccttacc
gctgtgcctgccagggcggagcccatccacagcggcacagaatcaccggcggcaccggcg
gccctgtggaagcaacgtcccgacggtttcgcgtcccttcccggcaacggcctggacggc
accaccggaggccaggcggggaggcacgtgagcgtgtcctcgctggaggaactcaaaacc
catgccgcggccgaggagccgctggtgatcttcctcaagggcagcatcacggcccaggac
tacgtcaagattccggtcgcctcgaacaagagcttcatcggtacgggcgcgggcgtggag
ctgatcaatgccggcttcaaactcatcaacgtgtccaacgtgatcttccggaacttcaca
gtccgtgattcctacattcccggcgactgggacggcaagcgcccggacaacgaccgtgac
gggatccaactggatacctcgcaccatgtctgggtggaccacatgaagttcgagcgcatg
ggcgacggcatgatcgatacccgcaaggactcggactacctgacctactcgtggaacgtg
ttcgcggacaacaacaaagccttgggcgttggctggaccggcaacgcagtcaccaaaatg
accatccatcacaactggatccgcaacactgtccagcggaacttcagcctggacaacaca
gcggctgcgcacgtctacaacaactacctgcaggacatcggacagtacggaatgatgggc
cgcaacgccgccaaggtggtcctggagggcaactacttcaccgcggttgccgatcccgtg
gtggcaaaggaccctgccacggaaatcgtcaaccgtgacaacattttcgagtccacccgc
ggccgcaaggacaacgtcggcagcgccttcgaccccacacagttctattcatacgccaag
gacgactctgcgagggttcccgaactggtcaccggcagtgccggacctcgcgaaaacaaa
gcaccaagcacgacggcggaggtcacggtcgcgctggacggcaccggcgatttcggcagc
gtacaggcggccatcggctcgattcctgtgggcaacacacaaccccggaccatcaccatc
aagcccggcttctaccgggaagcggtgaatgtctgggccgaccggcccaacgtgacgttg
cagggagcaacagccaacccggccgacgtcgtcatttcctacgacacccctgcaaacggc
gcgaagttcttcggcggaacctggggcgctgcgggcagtgccacgctcaacgtcctggcg
gaaaacaccacggtccggaacctcacagtggaaaacgcttatgacgaggccgttcacgga
ggtagccaggccctcgcggtgcggacggtggcagacaaaatcaccttcgacaacaccagg
ttcctcggcaaccaggacacctacctcgcagacaccaccggccgtgacgctaccgcccgc
acctatctgaaaaactgctacatcgaaggtgacgtggacttcctctacggccgcggcaca
gcggtgtttgacggctgcaccatccattcgctggaccgcggcagcgacacgaacaatggc
tacatcgtggcacccagcaccaaggactccaacccttacggcttcctgatcgtggacagc
accctgacctctgacgctgcacccgggaccgtcagtttgggacgcccttggtttgccagc
agcgaccccaacgcgcaccccatggccgtcatccgggactcgaacctgggcagtcacatc
gctgagcagggctggtcagacatgagtggccatgcttggactgaagggcgcttcgctgag
ttcaacaacaccgggcccggcgcatacatcaacgagttccacccccaactcactccggaa
gagggcctgaaattcactaaggacacgttcctcggtgactggactccggcagcaggtgct
taa

DBGET integrated database retrieval system