KEGG   Arthrobacter aurescens: AAur_0342Help
Entry
AAur_0342         CDS       T00447                                 

Gene name
adhT
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AAur_0342 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_0342 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_0342 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AAur_0342 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAur_0342 (adhT)
   00626 Naphthalene degradation
    AAur_0342 (adhT)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAur_0342 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(350923..352113)
Genome map
AA seq 396 aa AA seqDB search
MACPRGEAPWHEHRKAHGTRTPHSAVEQLTPCRETPADVRPGPDVRNPHQTLQNPKGRRM
YAAVLRAPGPIENHPLVYGEVPEPEPGPGEVSISVLACGVCRSNLHMVEGDWLPGTPAAL
PIIPGHEVVGRVKAVGPGVDNFAVGDRIGVQPIWSTCGRCGHCIGGYEQRCRQRQITGET
RDGGYAEVMLANAAFACKIPDSLSDTEAAPLFCPGITAYGAVKKAQPRPGQNVAVFGVGG
VGHLALQMAGLTGAHVNAVSRSASARALAEQLGAHGAYVPAGSDGGRELRDGSQDAAIVF
APSDLAVAEALRVIKPGGVVVLGVAQSLGVMDIGDEKTVVGTVLGTRQDMADVLTLAVDG
KLHAVHEDFPLSEANLVLQRLKKGQLHGRAVLVPGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttggcttgcccgcgaggcgaagcgccgtggcatgaacatcggaaagctcatggaacgcgg
actcctcacagcgccgtcgagcaactaactccctgtagggaaacccctgcggacgtccgg
cctgggccggacgtccgcaaccctcaccaaaccctgcaaaacccgaaaggcagacgcatg
tacgccgccgtcctacgtgcccccgggcccattgagaaccatccgttggtctacggcgag
gtccctgaacccgaacccgggcccggtgaagtttcgatcagtgtgctcgcctgtggggtc
tgccggtccaacctccatatggtcgagggcgactggcttccgggcacaccggccgctcta
cccatcattccgggccatgaggttgtgggccgggtgaaggctgttggtcccggcgtggac
aacttcgcagtgggcgaccggatcggtgtccagcccatctggtccacctgcggccggtgc
gggcactgtatcggcggctatgagcagcgttgccgccagcggcagatcaccggggagacg
cgcgacggcgggtacgcggaagtcatgctcgcgaacgccgccttcgcctgcaagatcccc
gactccctctccgataccgaagcggcgcccctgttttgtccagggatcaccgcctacggc
gcggtgaaaaaggcccagccgcgccccgggcagaacgtggcagtattcggcgtcggcggc
gtcggccacttggcactgcagatggccgggctcaccggagcgcacgtcaacgcagtttcc
cgcagtgccagtgcccgcgccctcgccgaacagttgggcgcacacggcgcctacgtgcct
gccggaagcgacggcgggcgggagcttcgggacgggtcccaagatgccgccatcgtcttc
gccccgtcggacctggccgttgccgaagcactgcgcgttatcaagcccggcggcgtcgtg
gtgctcggcgtggcacagtccttgggcgttatggacatcggtgatgaaaaaactgtggtc
ggaacagtgctcgggacccgccaggatatggccgacgtcctgaccctcgcagtggatggc
aaactccacgccgtccacgaggacttcccgcttagcgaggccaacctggtgctacagcgg
ctcaagaagggccaactccatggtcgcgccgtcctggtgcccggcgcatga

DBGET integrated database retrieval system