KEGG   Arthrobacter aurescens: AAur_0360Help
Entry
AAur_0360         CDS       T00447                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
aau  Arthrobacter aurescens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAur_0360
   00330 Arginine and proline metabolism
    AAur_0360
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AAur_0360
Enzymes [BR:aau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AAur_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371196..372212
Genome map
AA seq 338 aa AA seqDB search
MVNSNVEGVEQSVSTGTLPGWEQVDSLVAASHDRNRGCKDGAVADYIPVLAQADPELFGV
CVVEVDGGVHVTGDADVEFSIQSISKAFVYALVCEEFGHAAMADLVGVNNTGLAFNSVIA
IELNDGHPMNPMVNAGALATTALMPGSAPDKQWDAIHSGLSAFAGRDLVLDEVVYRSEAV
TNTRNRAIARLLESYGRIGRDPLEVVDVYTKQCSLRVSARDLAIMGATLADGGVNPVTGK
RVVSAEVCRDTLAVLAANGLYERSGEWLFEIGLPGKSGVSGGLLTVSPGKAGIGAFSPRL
DPAGNSVRGQQATAYLSRVLGLNIFASQAYAPNESRGY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaattcaaatgttgagggcgtggaacagtcagtttccacgggaacactgccgggc
tgggagcaggttgattcgctggtagccgcctctcatgaccggaatcgtgggtgcaaggac
ggtgcggttgcggattacattcctgtcttggcccaagccgatcctgaactcttcggcgtt
tgtgtggtggaagtggacggtggagtgcatgtgaccggcgatgccgacgtggagttttcc
attcagtccatctccaaggccttcgtgtatgccttggtctgcgaggaattcgggcatgcg
gccatggctgacctagtgggggtgaacaacaccggcctcgcgttcaactccgtgattgcc
atcgagctcaatgacgggcaccccatgaaccccatggtgaatgccggtgcgctggccacc
acggccctgatgcccgggagtgcgcctgacaagcagtgggacgccatacactcaggacta
tccgctttcgcaggccgggatctggtactggatgaggtggtctaccggtccgaggctgtc
accaacacccgcaaccgcgccattgctcggctcttggaaagctacggcaggatcgggcgc
gacccgctggaagtggtggacgtctacaccaagcaatgctcactgcgggtcagcgcccgc
gatctggccatcatgggcgccacacttgccgatggcggggtcaacccggtcactggcaag
cgcgtggtttcagccgaagtatgccgggacaccctcgcggttcttgcggccaacgggctg
tatgaaaggtcaggggaatggctgtttgagatcgggctcccaggtaagtccggagtgtcc
ggcggactgctcacggtctcgcccggcaaagccggaatcggagccttttcaccacggctc
gatcccgcggggaacagcgtccgcggccaacaggccaccgcgtatctctcccgcgtcctg
ggcttgaatatcttcgcgtcccaagcgtacgcaccgaacgaaagccgcggttattga

DBGET integrated database retrieval system