KEGG   Paenarthrobacter aurescens: AAur_0500Help
Entry
AAur_0500         CDS       T00447                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00071  Fatty acid degradation
aau00280  Valine, leucine and isoleucine degradation
aau00281  Geraniol degradation
aau00310  Lysine degradation
aau00360  Phenylalanine metabolism
aau00362  Benzoate degradation
aau00380  Tryptophan metabolism
aau00410  beta-Alanine metabolism
aau00627  Aminobenzoate degradation
aau00640  Propanoate metabolism
aau00650  Butanoate metabolism
aau00903  Limonene and pinene degradation
aau00930  Caprolactam degradation
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AAur_0500
   00650 Butanoate metabolism
    AAur_0500
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_0500
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAur_0500
   00310 Lysine degradation
    AAur_0500
   00360 Phenylalanine metabolism
    AAur_0500
   00380 Tryptophan metabolism
    AAur_0500
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAur_0500
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AAur_0500
   00281 Geraniol degradation
    AAur_0500
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAur_0500
   00627 Aminobenzoate degradation
    AAur_0500
   00930 Caprolactam degradation
    AAur_0500
Enzymes [BR:aau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AAur_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABM08526
UniProt: A1R246
Position
513121..514185
Genome map
AA seq 354 aa AA seqDB search
MESVGSDEEVLFERRGNLGIVTLNRPKAVNALNAGMVKTMLSQLTDWAADDAVATVLVRG
AGDRGLCAGGDIVAIYKDMLHGGTETAEFWADEYRLNALISHYPKPYVAFMDGLVLGGGV
GISAHGSVRVVTERTRTGMPETTIGFVPDVGGTLLLSRSPGETGTHAGLTGAHLSGADAL
FLGLADHFVPSQSLPALAEALESSTATAAVERFAQAAPDSALAAQREWIDAAYAHDDAEE
IVRSLRTLGDEAAAAADTIEAKSPTSVKVALESLRRVHGMSLEEALDQEYRVGLRCLAGP
DFREGIRAQVVDKDRNPQWKPATLAEVQASDVEGYFAPLGERELGLSVSPVQAN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgtggggtcagacgaagaagttctgtttgagcgccgcggcaatctgggcatc
gtgacgctcaatcgccccaaggcagtcaacgcactgaacgctggaatggtgaaaaccatg
ctcagccagttgacggattgggcggccgacgacgccgttgccaccgttttggtgcgcggc
gcgggcgaccgtgggctgtgcgccggtggcgacatcgtggccatttacaaggacatgctg
cacggcggcacggagacggccgagttctgggctgacgaataccggctcaacgcgctcatc
tcgcactatcccaagccatacgtcgcgttcatggacgggctggttttgggtggcggcgtg
ggtatttcggcgcacggttccgttcgcgtggtcaccgagaggacgcgcaccggcatgccg
gaaaccaccatcggtttcgtccccgacgtcggaggcacccttttactttcacgctcaccg
ggggagaccggaacgcatgcagggttgaccggagcgcacttatccggtgcggacgcactg
ttcctggggctcgcggatcacttcgtgccgtcccaaagcctccccgcgttggcggaagcg
ctggaaagctcgacggcgacggccgccgtcgagcgctttgcccaagccgcgccggactcg
gctctcgcggcacagcgggagtggatcgacgccgcgtacgcgcatgacgatgctgaggaa
attgtgcggagtcttcggactttgggcgacgaagcagccgccgcggcggacacgatcgag
gcgaaatcgccaacttccgtgaaggtggcgcttgagtccttgcggcgggtccatgggatg
tccctcgaggaagcactggaccaggaataccgcgtgggcctgcgatgccttgccgggccc
gatttccgggagggcatccgcgcacaggtggtggacaaggaccgtaacccgcaatggaag
ccggcgacgctcgctgaagtccaggcgtccgacgtcgagggctacttcgcgccgctcggc
gaacgggagttggggctttcagtcagtccagtccaggcgaattga

DBGET integrated database retrieval system