KEGG   Arthrobacter aurescens: AAur_0676Help
Entry
AAur_0676         CDS       T00447                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aau  Arthrobacter aurescens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AAur_0676
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AAur_0676
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AAur_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
698768..699250
Genome map
AA seq 160 aa AA seqDB search
MTSLYSIPLTFNDGTEADFGRFEGKAVLVVNVASECGYTRQYAGLEELYGKYRAQGLEIL
GVPCNQFGGQEPGADDVIAEFCERNFGVTFPLTSKANVLGKQQHPLFAELTRDEDGQSAK
VKWNFEKFVINRGGELVARFPSAVEPDSEDLMEAVEKALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgtacagcattcccctcaccttcaacgatggcaccgaagcggacttcggc
cggttcgagggcaaagcggtgctggtggtgaacgtcgcttccgaatgtggctatacgcgc
cagtacgcgggcctggaagagctgtatggaaagtatcgggcgcagggtttggaaatcctc
ggcgtgccctgcaaccagttcggcgggcaggagcccggcgctgatgacgtgatcgccgag
ttctgtgaacgcaattttggtgtgaccttcccgctcaccagcaaagccaacgtcctgggc
aagcagcagcatcccctgttcgcggagctgacccgggacgaggacgggcagtcggccaag
gtgaagtggaacttcgaaaagttcgtcataaatcgcgggggtgaactcgtggcaaggttc
ccatccgcagtggagcctgactccgaagaccttatggaagcagtggaaaaggcgctgttg
taa

DBGET integrated database retrieval system