KEGG   Arthrobacter aurescens: AAur_0721Help
Entry
AAur_0721         CDS       T00447                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aau  Arthrobacter aurescens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_0721 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAur_0721 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_0721 (aceB)
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AAur_0721 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745201..746853)
Genome map
AA seq 550 aa AA seqDB search
MNSFTDNFTINGITITAQPICRQNEVLTPDALEFIGKLHRSTADRRQELMQARHARRNQI
SGGQDPRFLPQTEAIRNDPSWRVAPPAPGLEDRRVEITGPVDKKMTINALNSGAKVWLAD
MEDSSTPTWRNVIQGQLNLTDALERRIDFTSPEGKEYKLKSAEDLPTIVVRPRGWHLPEK
HMLIDGKPIAGGIVDFGLFFFHNARRLIAQGKGPYFYLPKIENHLEARLWNDIFVLAQDL
LGIPQGTIRATVLIETITAAFEMEEILYELRDHASGLNAGRWDYIFSLIKNFRTRGPRFV
LPDRGQVTMTQPFMRAYTEQLVRACHRRGAMAIGGMAAAVPNRKDEAANQASFEKVRADK
TREANDGFDGSWVAHPDLVPVCREVFDEVLGDRPNQLDRSREDVTPDDRALIDIASTEGT
ITEGGVRLNIEVGIRYIESWLRGNGAVAIHNLMEDAATAEISRSQLWQWIHSHAITDHGD
IITREWVEDMLDEEYARLERFDGDRFADARAIFEEVTLAEEFPTFLTIPAYARFLTEARE
EATEEELVAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcactgacaacttcactatcaatggcatcaccatcaccgcgcagcccatt
tgccggcagaacgaggtcctcacgccggacgccctcgagttcattggcaagttgcaccgg
tcgacggcggatcgtcgtcaggagctgatgcaggcacggcacgcccgccgcaaccaaatt
tcagggggccaggatccgcggttcctgccgcagaccgaagccatccggaacgacccgtcg
tggcgagtggctcccccggcacctggtttggaggaccgccgcgtggagatcacgggcccg
gtggacaagaagatgaccatcaacgccctgaactccggtgccaaggtttggttggctgac
atggaagactcgtccacaccgacgtggcggaacgtgatccaagggcagctgaacctgacc
gatgctttggagcgccggatcgatttcacttctcctgagggcaaggaatacaagctgaag
tcagccgaggacctgcccaccatcgtggtccgcccccgtggctggcatctgccggagaag
cacatgctgatcgatggcaagccaatcgccggaggcatcgtggacttcgggctgttcttc
ttccacaacgcccgccgcctgatcgcccagggcaagggcccgtacttctacctgccgaag
atcgagaaccacctcgaagcccgcttgtggaatgacattttcgtcctggcccaggacctg
ctcggcatcccgcagggcaccattcgcgccacggttctgatcgaaaccatcacggctgcg
ttcgagatggaagagatcctctacgaactgcgtgaccacgcttcgggtttgaacgccgga
cgttgggactacattttctccttgatcaagaacttccgcacccgtggaccgcgttttgtc
ctcccggaccgcggccaggtgaccatgacccagccgttcatgcgcgcttacacggagcag
ctggtccgggcttgccaccgccgcggtgccatggctattggtggcatggctgctgctgtt
cccaaccgcaaggacgaagcagcaaaccaggcttcgttcgagaaggtccgtgcggacaag
acccgtgaggccaacgacggcttcgacggttcatgggtggcccacccggacctggtgccg
gtgtgccgggaagtctttgacgaagttctcggagaccgccccaaccagctggaccgttca
cgcgaggacgtcactcccgatgaccgcgcactgatcgacatcgccagcaccgagggcacc
atcaccgagggcggggttcgcctgaacatcgaagtgggcatccgctacatcgagtcctgg
ctgcggggcaacggagctgtggccatccacaacctcatggaagacgccgccaccgcggag
atctcccgctcccagctgtggcagtggatccactcccacgccatcactgaccacggtgac
atcattacccgcgaatgggttgaggacatgctggatgaggaatacgcccgactggaacgc
ttcgacggagaccgcttcgctgatgcccgcgccatcttcgaagaagtcaccctggccgag
gaattccccaccttcctgaccatccccgcgtacgcccgtttcctcactgaggcccgtgaa
gaggccacggaggaggaactcgtcgcggcctag

DBGET integrated database retrieval system