KEGG   Paenarthrobacter aurescens: AAur_0751Help
Entry
AAur_0751         CDS       T00447                                 

Gene name
sufC
Definition
(GenBank) iron(III)-transport ATP-binding protein
  KO
K02010  
iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
aau  Paenarthrobacter aurescens
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AAur_0751 (sufC)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     AAur_0751 (sufC)
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    AAur_0751 (sufC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(779431..780546)
Genome map
AA seq 371 aa AA seqDB search
MAPTTNAHLDIREVTKNFGSQAVLKGVNLSVAKGGTTAIVGPSGSGKTTLLRLIAGFEHP
DTGSISLNGSRVAGEGEWVPAHKRQVGYVAQDGALFPHLTVGQNVAFGLDSGKLDGGRGA
VRSRVQELLEMVSLDASMAKRRPHQLSGGQQQRVALARALAREPELMLLDEPFSALDAGL
RVATRRAVAKVLSAAGVTTILVTHDQAEALSFADQVAIMRGGKLAQIGNPFVVYTRPADR
ATAEFLGDAVILEAWMEGSLATCSLGGIPVRRPPAQGRVQLMLRPEQIRIASDGPIRGVV
VDTDYFGPETTVRIKLGEYTAPDGGASGNSHRYPGGGEIITIRHWNASITKPGTELCLRV
VGEGVAFPSET
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggctcccaccactaatgcgcacctggatatccgggaggtcaccaagaactttggctcc
caagccgtgctgaagggcgtgaacctctccgtcgccaaaggcgggaccactgcgatcgtg
ggcccttccggttcaggcaagaccacgctgttgaggttgatcgcgggctttgagcatcct
gacaccggttccatcagcctgaacggttcccgggtggccggagaaggcgagtgggtgccc
gcgcacaaacggcaggtagggtacgttgcccaagacggcgccttgtttccgcacttgacg
gtgggacagaacgtcgcgttcggcttggattcaggaaagctcgacggcggtcgcggcgcc
gtgaggtcgcgggtgcaggaactgcttgagatggtgtccttggatgcgtccatggccaag
cgccggccgcaccaattgtccggcggtcagcagcagcgggtcgctttggcccgggcgttg
gcccgggaacctgagctcatgctccttgacgaacctttttcagcgctcgacgccggactt
cgggtagccacccgcagggccgtagccaaggtgctcagtgctgccggtgtgaccaccatc
ctcgtgacccacgatcaagccgaagcgctctccttcgctgaccaggtcgccatcatgcgc
ggcggcaagctggcccagataggcaacccctttgtggtttacacccgtccggctgatcgc
gccacggctgaattccttggcgacgccgtgattcttgaggcgtggatggaaggctccctg
gccacgtgctcgctgggcggaattccggtccgccgcccgccggcgcagggaagggtgcag
ctgatgctgcggccggagcaaatccgcattgcctccgatgggcctatccgcggagtggtg
gtggacacggattacttcgggccggaaaccactgttcgtatcaagctgggtgagtacacg
gccccggacggcggcgcgtcgggcaacagtcaccgctaccctggcggcggggagatcatc
accatcaggcactggaacgcttcgatcaccaagcccggcactgaattgtgtctgcgcgtg
gtgggcgaaggcgtggcgtttccgtccgaaacctga

DBGET integrated database retrieval system