KEGG   Paenarthrobacter aurescens: AAur_0752Help
Entry
AAur_0752         CDS       T00447                                 

Gene name
sfuB
Definition
(GenBank) Iron(III)-transport system permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02010  ABC transporters
Module
aau_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AAur_0752 (sfuB)
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    AAur_0752 (sfuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABM07363
UniProt: A1R2U1
Position
complement(780594..782195)
Genome map
AA seq 533 aa AA seqDB search
MTTDLSAPNVPQSEGSTTTAGRGKRPRPPFGVSTVSLLAVLIALFSLIPLGYVLYMTAAT
GWDTVVDLIVRPRVGELLLNTVLLMVFTVPLCLGLGVGGAWLVERTRLRGHRWWAVLLAA
PLAIPAFVNSYSWVSAVPSLEGLWSGVLIATLSYFPLVYIPAAATLGRLDPAIEQSAASL
GLGSWAVFFRVVLPQLRIAMTGGALLVALHLLAEYGAFAMIRFDTFTTAIMVQFQSTFNG
TAGNMLASVLVLLCLLLLLAEVKSRGTARYARIGSGAQAKAIRLPLGAYQLPAQLALLAL
TVLAFGLPLWFVLKWVMAGGSDVWAAEELIPALSQTLMYGAAGALVTTVVAFPMAYLAVR
HPSWFSKMLELSNYITSSLPGIVVGLAFVTVSIRVVPGVYQTAGVLIAAYVLLFLPRALV
NIRAGLAQAPKELDEAAQSLGKTPLESFFKVTLRLTAPAAAGGAALVFLAIVNELTATLL
LSPNGTRTLATEFWSKSSEIDYAGAAPYALLMILLSAPMTYLLFQQSKKVAGQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactgatctatcggctcccaacgttccacagtctgagggaagcacgacgacggcg
ggccggggcaagcgcccccgcccgcctttcggcgtttccacggtgtccttgctggcggtg
ctgatagcgctgttttccctgattccgctgggctatgtcctgtacatgacggcggcgacg
ggttgggacacggtggtggatctcattgtgcgtccccgtgtgggcgaactcctgctgaac
actgtgttgctgatggtcttcacagtgccgctatgcctggggctcggagtgggcggtgcc
tggctggtggaacgaaccaggctccgcggacaccgctggtgggcggtgctgttggccgcg
cctttggctatcccagcgttcgtcaacagctactcctgggtgtccgccgttccttccttg
gaaggactctggtccggtgtgctgatcgccacgttgtcctacttcccgttggtgtacatc
cctgccgcggcgacgcttggccggttggaccccgccatcgagcagtccgcggcatcgttg
ggcctgggttcctgggccgtgtttttccgcgttgtcctgccgcaactgcgcattgccatg
accggtggcgccctgctggtggccctgcatctgttggctgagtacggtgctttcgcgatg
atccgctttgatacgttcaccacggcgatcatggtccaattccagtccaccttcaacggc
actgccgggaacatgctggcaagcgtcttggtgctcctgtgcttgctgctgctgctggcc
gaagtcaaaagccggggcacggcccgctacgcccggatcggctccggcgcgcaggcgaag
gctatccgcctgcctctgggggcctaccaattgcctgctcagcttgcactgctggccctc
actgtcctggccttcgggttgccgctctggtttgtgctgaagtgggtgatggcgggcggt
tcggacgtatgggcggctgaagagttaatcccggcgctctcgcaaaccctcatgtacggg
gcagcgggggcactggtcaccacggtggtggcattccccatggcttacctggctgtaaga
cacccgagctggttcagcaagatgttggaactgtccaattacatcaccagttcgctgccc
ggaatcgtggtgggcctggcgttcgtcaccgtcagcatccgggtggtccccggggtttat
cagaccgcgggggtcctgatagcggcgtacgtcctgctgttccttccgagggccttggtg
aacatccgtgctggcttggcacaagcccccaaagaactcgatgaggccgcgcagtccttg
ggcaagacccctttggagtccttcttcaaggtgacgttgcggctcactgccccggccgct
gccggcggtgctgcgttggtgttcctggccatagtcaacgagttgacggccactttgctc
ctctcgcccaacggtacgcgcacgttggccactgaattttggagcaagagcagcgagatc
gactacgccggcgccgcaccttacgcgttgctgatgatcctgctgtcagcccccatgaca
taccttctcttccaacagtccaagaaagtagccggacagtga

DBGET integrated database retrieval system