KEGG   Paenarthrobacter aurescens: AAur_0754Help
Entry
AAur_0754         CDS       T00447                                 

Definition
(GenBank) putative alpha-1,6-mannanase
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_76
Motif
Other DBs
NCBI-ProteinID: ABM10183
UniProt: A1R2U3
Position
complement(783424..784506)
Genome map
AA seq 360 aa AA seqDB search
MTRSFGRRLLFLPGTHIGAVSLPSNTLKSISGPWHYWWQAHYVDCLVDAGRRELASKTKF
DGASRPSAGRLASRLVTTIRLRNLLRFVNDYYDDMAWLALATLRLEKLAEETKKPGRRRN
AYVQKSLTLQFDSASTDHLGGGTFWSTKRDFKNTPATAPVALYYARTGHQERAQSLVTWL
NNKLLHPERGVYLDGLRISNGKTELDAAIYTYNQGPVLGALLELGGEDNLRRAALLVDAV
ERELTLPGTQVVRGDGTGDGGLFTGILLRYLALAARDARLPATTRETATSLVRSTADALW
TGRRENQNQATSRRGTPAIVFSFDPQRPASETYPVGAAVELSTQLQAWMALEAAASIPSN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgaagcttcggtaggcgactgctcttcctgccaggtacccacatcggcgcggtg
agtctgcccagcaacaccctcaagagcatctccggcccttggcactattggtggcaagcg
cactacgtcgattgcctggtggacgccggccgccgtgaactcgcgagcaaaacaaagttc
gacggcgcctcccgccctagtgccggccggctcgcttcacggctggtcaccactatccgg
ttgcggaatctgctgcgtttcgtgaacgactactacgacgatatggcgtggctggccctc
gccacgctgcgcttggagaagctggcggaggagaccaagaagcctggtcgccggcgcaac
gcgtacgtccaaaagagcctgacgctgcagttcgattcggcctctaccgaccaccttggt
ggcggcaccttttggagcaccaagcgcgacttcaagaacacacccgctactgcccccgtg
gccctctattatgcgcggacaggccaccaagagcgcgcgcaatcactggtgacctggctc
aacaacaaactcctccacccggaacgcggcgtgtacttggatggtttgcgaatcagcaac
ggcaaaacagagctggatgcggccatctacacctacaaccagggcccggtcctgggtgcg
ctgctggaactgggcggtgaggacaatctgcgcagagccgccctgcttgtggacgccgtg
gaacgcgaactgacgcttcccggcacgcaggtggtccgcggtgacggcacaggagatggc
ggcctctttaccggcatcctgctccgctacctcgcgctggctgccagggacgccagactc
ccggcgacaacgcgagagacggccacgtccttggtgcgcagcacggccgatgccttgtgg
accggccgccgcgagaaccagaaccaggccacgtcccgccgcggaactcctgccatcgtc
ttctcattcgacccccagcgaccggcgagcgaaacgtatccggtgggggccgccgtcgag
ctttccacgcagcttcaagcctggatggcactggaagccgccgcgagcattccaagcaat
taa

DBGET integrated database retrieval system