KEGG   Paenarthrobacter aurescens: AAur_0755Help
Entry
AAur_0755         CDS       T00447                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ABM08674
UniProt: A1R2U4
Position
784710..785504
Genome map
AA seq 264 aa AA seqDB search
MDIKGTVALVTGGASGLGAATAKRLFDAGASVVLVDLPQSAGDAYAAELNAAGSGEARAV
FAPADVTNESQVQAAVHAAMALGPLRIVVNCAGIATPGKVLGREGVLPLETFNKVIQINL
VGTFNVIRLAAAAMVETEPVSTELGGPERGVIINTASVAAFEGQIGQPAYAASKGAVAAM
TLPLAREFARSLIRVATIAPGIFETPMMAGLPQSAQDSLGQQVPHPARLGRAAEYANLAA
HIVENAMLNGETIRLDGAIRMGLK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaagggcacagtcgcgctggttaccggcggggcatcagggctgggggcggct
accgccaagcgcttgttcgacgccggggcctcggtggtgctggtggatctgccacaatct
gccggggacgcctatgccgccgagctgaatgcggcaggttccggtgaggcacgcgcggtc
tttgctcccgcggacgtcaccaacgagtcccaggtccaggccgccgtccacgccgccatg
gctttggggccactgcgcatcgtggtcaattgcgccggaatcgcgacccccgggaaagtt
ctgggccgcgaaggcgtactgccgctggagaccttcaacaaggtcatacagatcaacctc
gtgggcaccttcaacgtcatccgcttggccgcagcagccatggtggaaaccgagcctgtc
tcaacggaactgggtgggcccgaacgcggcgtcatcatcaacaccgcgtccgtggctgcc
ttcgaaggccagatcggccagcctgcctacgccgcatccaaaggtgcggtggcggccatg
acactccccttggcgcgggagtttgcccgttcactgatccgggtggccaccattgcaccc
ggcatctttgaaacgcccatgatggccggacttccccagtcagcccaggactcccttggc
cagcaggtcccgcatccagcacgccttggccgcgccgcggaatatgcaaacctggcggcc
cacatcgtggaaaacgccatgctcaacggggaaaccatccgactcgatggcgccatccgt
atggggctcaaatga

DBGET integrated database retrieval system