KEGG   Paenarthrobacter aurescens: AAur_0758Help
Entry
AAur_0758         CDS       T00447                                 

Definition
(GenBank) hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(787923..788792)
Genome map
AA seq 289 aa AA seqDB search
MTRFIQCVEPRRQKTSLTGDPGASSSRNNAAMHCSDMTSFRRKSLADCTFSRHPLLRKWQ
DTSYQAGWRFRADWFLPEVGTVVASLAKSAVIPGPTAKSLGAARARNGVGITETMADFRA
LFAAAGKNVDVEALQSLAEGWAEAMETAPPVSCTDVYTGLATQAHFRRRLHEISTFGSER
PGTVVLAIISMAGPRNSLNHSWTLLARIGEAVNGQLDGTGAMAMYQNSAIHVLFPLSESN
ISRVIECKIAVEALGDGALSPARTKFYPLPSAAPATTTTAPRDSSCERQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcggtttatacaatgtgttgaaccaagacgccaaaagacttctttgacaggcgat
cccggagcatcttcgtcacgaaacaacgctgctatgcactgttcggatatgacatcgttc
cggagaaaatcactcgcagattgcacgttctcgcggcaccctttgctgcgaaaatggcag
gacaccagctatcaggcaggttggcggtttcgtgcggattggttcctgccggaagttggg
actgtggtggcttccctcgcgaagagcgcggtgatcccagggcccacagccaagtcgctt
ggcgctgcccgtgccaggaatggtgtcggcatcactgagaccatggctgacttccgtgct
ctcttcgctgccgcagggaagaatgtggacgtcgaagctctgcagtccctggcagaaggg
tgggcggaagccatggaaacggcgcccccggtttcgtgtacggatgtctacacggggttg
gctacccaggcccatttccggcgtcgtctccacgagatctcaacatttggatccgaacgg
cccgggacggtggttctggccatcatctcgatggccggcccccgcaacagtttgaaccac
tcctggacgctgctggcacgtatcggagaagccgtcaatggccagctggatggaaccgga
gcaatggctatgtaccaaaactcggccatccatgtccttttccccctcagcgagagcaac
atatcccgggtcatcgagtgcaagatcgctgtggaagccctgggtgatggcgccctcagc
cccgctcgcaccaagttctatccgcttccgtcggcggcgcctgccaccaccacaacggcg
ccacgggattcttcctgcgaaaggcaatag

DBGET integrated database retrieval system