KEGG   Paenarthrobacter aurescens: AAur_0759Help
Entry
AAur_0759         CDS       T00447                                 

Definition
(GenBank) putative Sigma-70 region 2 domain protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
788858..790504
Genome map
AA seq 548 aa AA seqDB search
MAHGAHTGRNVNMEGEVDSDQHLIELVRGGDISAFDGLYKRHLSIASSIAKRNVDNPSDA
EDVVAEAFQSVLQSIVGGKGPRAFFRAYLLSIVTRLSHQRNRKSNKILLSGDDPVLDEAL
VESDAVISAFESRTVAKAFRALPERWQAVLWYMDVERMKPAAVAPILGVTPNAVSALAVR
AREGLRRQYLQSHLANQTGRCAEFASKLGSFLRGGLPSATERMVRNHLDSCSTCTAALTE
LEDVQGSMRAVLLPLVTGIPLAMWAGKGAALGFLSGMVPAKVALAVPALAQPAVMALFAA
AGVGLMLGAGGLAEGLAPEIFAEQQTVETSAARIESDLRLASPSPSQTEAPDPAPSAQTQ
PLPAAPVPPPVEPLPVPAPEPVEPLPAPAPAESLPSPPKALPQPIATTPAPVSPPAKPPA
PAAPTGSSAAVPAKVSGTVREIRERSSSSGTAMEIDFNASGTGPLGSGKVVFSVGRHARI
VESSLRAPDGWECSMEGQSVVMCLTESVQRGSLHFHVTAESVRSRDGGVFNYSLSGKGLV
QGDFAYRY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacggggcacatacgggccgcaacgtaaacatggagggtgaagttgacagcgat
caacacctcattgagctggtgagaggcggagacatatctgccttcgatggactctataaa
cgtcacctgtccattgcgtcctccattgccaaacggaatgtcgacaatccgagcgacgcc
gaggatgttgtggctgaggcttttcaatccgttctgcaaagcatcgtagggggaaaggga
ccgcgtgccttcttcagggcgtacctgctgtccatagtcacccggctatcccatcaacgc
aatcgaaaatcaaacaaaatcctgctcagcggtgatgatcctgttttggacgaagcactg
gtcgaatcagacgccgtcatcagcgctttcgagtcacgcacagtggccaaggcgttccgc
gccttgccggaacggtggcaggctgttctctggtacatggacgtcgaacgcatgaaaccc
gcagccgtggcaccgattcttggggtgacccccaacgccgtttctgcactcgctgtccgt
gcgcgtgagggcctacgacgccaatacctccaaagtcatctcgcgaaccagacgggcagg
tgcgccgaattcgcgtccaagcttggcagcttcctcaggggtgggctacccagcgctact
gaacgcatggttcgcaatcacctggatagctgttccacatgtacggccgcgcttacggaa
ctcgaagacgttcagggaagcatgcgggcggtactgctgcccctggtgacgggaatcccc
ttggctatgtgggcgggtaaaggcgctgcgctcggttttcttagcgggatggtcccggcc
aaagtagccctcgcagtccctgctttggcgcagccagccgttatggctctctttgcagcg
gcaggggttggcctgatgctgggggcagggggattagctgagggactggctccggagata
tttgcagaacagcagacagttgagacatccgcagcgcgaatcgaaagcgacttaaggctg
gcctccccgtcgccaagtcagaccgaggctccggacccagcaccgtcggcacagactcag
ccgctgcctgccgcacccgtgccgccccccgttgagcctcttcccgtgccggccccggag
ccggttgagcctcttcccgcgccggccccggcagagtccttgccgtcgccgccgaaggcg
ttgcctcagccgatagctacgactcctgcccccgtttcgccgccagcaaagccccccgcg
ccggccgctcctaccggttcgtcagcggccgtcccggcaaaggtctcgggcaccgtacgg
gagatccgtgagagaagtagctccagcggtaccgccatggaaatcgacttcaatgcctcc
ggcaccggccccttgggcagcggcaaggttgtgttttcggtaggaaggcatgcgcgcatt
gtggagagctcactgcgtgcgcccgacgggtgggagtgttccatggaggggcagtccgtc
gtcatgtgcctcacggaatcggtgcagcgaggcagcctccactttcatgtgaccgcggaa
tccgtacgctccagggacggcggcgtcttcaactattccttgagtgggaaaggtcttgtc
caaggcgacttcgcgtaccggtactga

DBGET integrated database retrieval system