KEGG   Paenarthrobacter aurescens: AAur_0768Help
Entry
AAur_0768         CDS       T00447                                 

Definition
(GenBank) putative integral membrane protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM08663
UniProt: A1R2V7
Position
complement(799581..800240)
Genome map
AA seq 219 aa AA seqDB search
MEQFTEVPGDRAVSVLAYSAAAVGVAGVLTLGAMYAVEVPRGGPFVFGAINDATGAVFNV
LVIPVIMQVHKRLPKAPWTEPLKWVTVAACAAGATSSALLVLKVLDFEPSTAVSVAAIVI
QGVWFLMANNKLLHVEDYPKVLAKLGRFIGGALLIGLPVAGLGFLLPGPEWLRYTVMGVG
FIAGASSWAAWPYWYFKAGRFLGHKRAAEAPRGASPEPA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattcactgaagtaccgggcgacagggccgtttcggtcctcgcctactctgca
gccgccgtgggcgtggcgggcgtcctgacgctcggggccatgtacgccgtggaagtcccc
aggggcggccccttcgtcttcggtgcaatcaacgacgccaccggagccgtgttcaacgtg
ctggtcatccccgtgatcatgcaggtccacaaacggctccccaaagcaccgtggactgag
ccgctgaaatgggtaacagtggcagcttgcgcggccggggccacgagctcggcattgctt
gtacttaaggtcctggactttgagccatcaactgcagtttccgtggcggccatcgtgatc
caaggggtctggttcctcatggccaacaacaagcttctccacgttgaggactacccgaaa
gtgctcgcgaagcttggccggttcatcggcggagcacttttgatcgggcttcccgttgcc
ggcctcggtttcctccttcccgggcccgagtggctccgttacacggtgatgggagtgggt
ttcattgccggggcgtcgtcgtgggcagcgtggccgtactggtacttcaaagcaggtagg
ttccttgggcacaagcgggcggctgaggcgccacggggtgccagcccggaaccggcgtga

DBGET integrated database retrieval system