KEGG   Paenarthrobacter aurescens: AAur_0769Help
Entry
AAur_0769         CDS       T00447                                 

Definition
(GenBank) putative RNA pseudouridine synthase
  KO
K06177  tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     AAur_0769
    5.4.99.29  23S rRNA pseudouridine746 synthase
     AAur_0769
Ribosome biogenesis [BR:aau03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    AAur_0769
Transfer RNA biogenesis [BR:aau03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AAur_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABM09135
UniProt: A1R2V8
Position
complement(800317..801246)
Genome map
AA seq 309 aa AA seqDB search
MQSPLPVRDGVNATRLRLPDEGPWTTAMDYMMHRWGHIDPQGIEDRFDAGEIVGEGGVPL
DRSTKLEDHTFIWYYRTLPPETRLPVEINILHQDEHILVVDKPHFLPTTPGGTYIQESAL
VRLRNLLNLPDLIPMHRLDRMTAGLLLLSTNPETRGKYQVLFEKRQVQKEYECVSAATPA
AGFPAVEFPAVVRNRMTKSRSYLLAEVIDGEPNAETRIEQTKTFDAGTHQRALYRLEPHT
GKTHQLRVHMASLGLGIVNDAFYPDLLDKAPDDYTKPLQLLARGITFVDPISKQPVEYRS
QLELSEAHA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcccccctccccgtgcgcgacggcgtgaacgcgacccgcctgcgcctgccggac
gagggaccgtggaccacagcgatggactacatgatgcaccgctggggacacatcgacccc
cagggcatcgaggaccgattcgacgccggcgagatcgtgggcgaaggcggtgtaccgctg
gaccgcagcaccaaactcgaggaccacactttcatctggtattaccgcacgctccccccg
gagacgcggctgcccgtcgaaatcaacatcctccatcaggacgagcacatcctggtggtc
gataaaccgcatttcctccccaccacacccggcggcacctacatccaggaatccgccctg
gttcggttgcgaaacctgctcaacctccctgacctcatccccatgcaccgcctggaccgc
atgaccgctggcctgttgctgctgtccaccaacccggagacgcgcggcaagtatcaggtg
cttttcgagaagcgccaggtccagaaggaatacgagtgcgtgtccgccgcgacgcccgcc
gcaggctttcccgccgtcgagttccccgcagtggtccgcaaccgcatgaccaagtcgcgc
agctacttgctggccgaagtcatcgacggcgaaccgaacgcggaaacgcgcattgaacaa
acaaaaacgttcgacgccggcactcaccaacgcgcactgtaccgtttggagccgcacacc
ggaaagacgcaccaactccgggtgcacatggcctccctcgggctgggaatcgtcaacgac
gccttctacccggacctgttggacaaggctccggacgactacacgaaacccctgcagtta
ctggcccgcggcatcacgttcgtggaccccatcagcaagcagccggtggaatatcgcagc
cagttggagctcagcgaagcccacgcctga

DBGET integrated database retrieval system