KEGG   Paenarthrobacter aurescens: AAur_0770Help
Entry
AAur_0770         CDS       T00447                                 

Definition
(GenBank) putative transcriptional regulator, ArsR family
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_24 HTH_5 TrmB MarR_2 HTH_IclR HTH_Crp_2 HTH_29 LexA_DNA_bind MarR HTH_12 HTH_28 z-alpha Rrf2 YdaS_antitoxin DUF2250 HTH_AsnC-type HTH_18 HTH_1 HTH_27 HTH_11 DUF2513 FaeA HTH_9
Motif
Other DBs
NCBI-ProteinID: ABM08032
UniProt: A1R2V9
Position
801399..802049
Genome map
AA seq 216 aa AA seqDB search
MLDIEVIEDPAAAEASLDPIRTRILQELSEPASATQLAAKVGLPRQKVNYHLKSLERHGL
VELVEERRKGNVTERVLRATAASYLISPVALASVAPDPRRFSDRFSAFWLLSLASRTVQE
MGKLIAGAAVANKKLASFAIDGEITFRSAAERAAFAEELGVAVTKLVDKYHDGGATAVAG
GARKHRLVVVLHPALKTPPIEHASSEKSAEKDHSND
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttggacatcgaagtcatcgaggacccggccgcggcggaagcttcattggacccgatc
cgcacccgcatcctccaggagctctccgagccggcgtccgccacgcaactggcggcgaag
gttggactgccccgccagaaggtcaactatcacctcaagtccttggagcgccacggcctg
gtggagttggtggaggaacgccgcaagggcaacgtcaccgagcgagtacttcgtgcgacg
gcggcctcgtacctcatctcaccggtggcactggcctccgtggccccggatccccggcgc
ttctcggaccggttctccgctttctggctcctatcgctcgcctcccgcacggtgcaggag
atgggcaagctcatcgccggcgccgccgtggccaacaaaaagctggccagcttcgcgatc
gacggcgagatcaccttccgctctgccgcggaacgcgcggcgttcgcggaagagctcggc
gtagcggtgacgaagctcgtggataagtaccacgacggcggtgctaccgcggtggcgggc
ggcgcacgcaagcaccggctcgtcgtcgtgcttcaccctgcccttaagacccctccaatc
gaacatgcctcctcggagaaatcagcagaaaaggaccacagcaatgactga

DBGET integrated database retrieval system