KEGG   Paenarthrobacter aurescens: AAur_0779Help
Entry
AAur_0779         CDS       T00447                                 

Definition
(GenBank) putative beta-1,3-glucanase
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
810048..811310
Genome map
AA seq 420 aa AA seqDB search
MKRRLMPLTMFVAGLTIAATLIAPEPSALAAAGMPAPGKLVWSDEFNGPAGTAPDPGKWT
HDTGGSGWGNGELQYYTSSTSNAAADGQGNMAITARKENPAGYQCHYGPCQYTSARLISA
GKFSRTQGRFEARLKVPKGQGMWPAFWMLGDNVFAQGWPASGELDVMENVGKEPGTVWGS
IHGPGYSGANASNASYTLPGGKALGDAFHTFTVDWGPDSITWYIDGISYSQKTKATTSGP
WVFDHDFFLLLNLAVGGYWPGAPNSGTQFPQSLLVDYVRVYELASGPARPVSPASTRIQG
YAGKCIDVAGRQAADGAPLHLWDCDTAASEQWTFAANGTIRSLGKCMDVAWGSTANGAPV
QLTSCNGNPAQQFVLNNAGDLVNPQANKCVDVVDWNSSNGARLQLWDCAGTTNQKWWRMA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaagactcatgcccctgacgatgttcgtcgcaggcctgaccatcgcagctacc
ctcatagccccggagccttctgcacttgcagccgctggcatgcccgcccccggaaaactg
gtctggagcgatgaattcaacggccccgccggcacggcgcctgaccccgggaaatggact
cacgacacgggaggatccggatggggcaacggcgaactgcagtactacaccagcagcacc
agcaatgccgcagctgatggccagggaaacatggccatcaccgcccgaaaggaaaaccct
gctggatatcagtgccactacgggccgtgccagtacacatccgcccggctgataagtgct
ggaaagttcagccggacacaaggccggttcgaagcccggctcaaagtgcccaaggggcaa
ggcatgtggcccgctttctggatgctcggtgacaacgttttcgcccagggctggcccgcc
agcggtgagctggacgtcatggaaaacgttggcaaggaacccggaacggtgtggggaagc
atccacggacccggctattcgggggcaaacgcctccaacgccagttacacactgcccggc
ggtaaggccttgggggatgctttccacacattcaccgtggactggggacccgattccatc
acctggtacatcgacggaatttcctactcacaaaagaccaaagccacaacgtccggaccg
tgggtcttcgaccacgatttcttcctcctgctgaaccttgccgtgggcggctactggccg
ggagcgccgaactcgggcacccaattcccgcagtcgttgctggttgactacgtccgcgtg
tacgagcttgcctcagggccggcgaggcccgtttcgccagccagcacgcgcatccaaggc
tatgccggaaagtgcattgatgtggccggtcggcaggctgctgacggggccccactgcac
ctgtgggattgcgacacagcggcatcagagcagtggaccttcgctgccaacggcaccatc
cgctcgctgggcaagtgcatggacgtggcgtggggttcaacggccaacggtgcaccagtc
cagctcaccagctgcaatggcaacccggcgcagcaattcgtcctgaacaatgccggggat
ctggtgaacccgcaggccaacaaatgcgtggacgtagttgactggaattcatccaacggt
gcgaggctgcagttgtgggattgcgccggtaccaccaaccaaaagtggtggcggatggcg
taa

DBGET integrated database retrieval system