KEGG   Paenarthrobacter aurescens: AAur_0784Help
Entry
AAur_0784         CDS       T00447                                 

Definition
(GenBank) hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF983
Motif
Other DBs
NCBI-ProteinID: ABM06690
UniProt: A1R2X2
Position
complement(818937..819557)
Genome map
AA seq 206 aa AA seqDB search
MRTSQSRAPFHALRSGAVSIVVVLLAAGAHIIGGGELPTAPVLLALVALTALAATLATRF
KLNLFTMAGLLGAGQLALHEAFTALSPITANVQGTNHHLGAEPLSSGLDVAATHTHELGT
AFGTMMFVGHVLATIASAVVLAKGEDALWQLAAWLRPLLALPTLVFRPDAGASPVAVGTP
NVFVPRPWRNLRQDSRRGPPAVVVLP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcacatcgcagtcccgggcaccctttcatgcgttgcggtcgggcgccgtctcgatt
gtggtggttctccttgctgcaggggcccacatcataggcggcggagaactccccacagca
ccggtcctgctggcgctcgttgcgctgacggccctggctgccacacttgccacccggttc
aagctgaaccttttcaccatggcggggctcttgggcgcgggacagttggcactccacgaa
gccttcacggccttgagcccgatcacggccaacgtgcaggggacaaatcaccacctcggc
gctgaaccgttgagctccgggctggacgtagcggcgacgcacactcatgaactcggcaca
gccttcggcaccatgatgtttgtgggccacgtgctcgccaccatcgcttctgccgtcgtc
ctggccaagggtgaggatgccctgtggcagctcgccgcctggctgcggccgctgctcgcc
ctgccaactttggtgttcaggcccgacgccggcgcctcgcctgtcgcggtcggcacaccc
aacgtctttgtcccccgcccttggcggaaccttaggcaagacagccgccgcggcccgccc
gccgtcgtcgtacttccttag

DBGET integrated database retrieval system