KEGG   Paenarthrobacter aurescens: AAur_0794Help
Entry
AAur_0794         CDS       T00447                                 

Definition
(GenBank) putative cytidine/deoxycytidylate deaminase
  KO
K11991  
tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     AAur_0794
Transfer RNA biogenesis [BR:aau03016]
 Prokaryotic Type
  tRNA modification factors
   Deaminases
    AAur_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(827169..827702)
Genome map
AA seq 177 aa AA seqDB search
MSATEPYHADHLAWMGLALDEARLALKTDDVPIGAVVLGPDGGVLGSGRNEREAHGDPTA
HAEIVAIREAAAALRQLAHDSGASGDGWRLEDCTLVVTLEPCAMCAGAIVLARIPRVVFG
AWDEKAGAVGSVFDILRERRLNHWVEVYAGVREDECAALLRDFFATHRVPAVEHRPV
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaccgagccgtatcacgcagatcacctggcctggatgggccttgccctggac
gaagcccggttggcgttgaaaacggacgacgtgccgattggcgccgtggtgttggggccc
gacggcggtgtgctgggttccggacgcaacgaacgggaagctcacggggacccgacggct
cacgcggagatcgtcgccatccgcgaagctgccgctgcgctgcgtcagctcgctcacgat
tcgggcgcctctggcgacggttggcggcttgaggattgcaccttggtggtcacccttgag
ccctgcgccatgtgtgccggggctattgtccttgcccgtattccccgcgtcgtgtttggc
gcgtgggatgagaaagccggtgccgtggggtctgtcttcgatatcctccgcgagcgccgg
ctcaatcactgggtggaggtgtacgcgggcgttcgcgaggacgagtgcgctgccttgctc
agggacttcttcgctacacaccgggtaccggccgtggagcaccgccccgtctga

DBGET integrated database retrieval system