KEGG   Paenarthrobacter aurescens: AAur_0795Help
Entry
AAur_0795         CDS       T00447                                 

Gene name
upp
Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00240  Pyrimidine metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AAur_0795 (upp)
Enzymes [BR:aau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     AAur_0795 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran
Motif
Other DBs
NCBI-ProteinID: ABM09757
UniProt: A1R2Y2
Position
827725..828360
Genome map
AA seq 211 aa AA seqDB search
MRTLVVDHPLVAHKLTVLRDKNTPSPVFRQLTEELVTLLAYEATREVKTQPVEIETPVTK
TVGTAFTKPTPLVVPILRAGLGMLEGMTKLVPTAEVGFLGMARDEETLDIITYAERLPED
LTGRQIFVLDPMLATGGTLREAIKFLFKRGASDVTCICLLAAPEGLSKLEEELSDANVKI
VLASIDEKLNEKSYIVPGLGDAGDRLYGVAG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacactcgtcgtggaccacccgctggtcgctcacaagctcaccgttctgcgggat
aagaacactccttcaccggtcttccggcaactcactgaagaactcgtcaccctcctggcc
tacgaagccacccgcgaggtcaagacgcagccagtcgagatcgaaacacctgtcaccaaa
accgtgggcacggcgttcactaaacccactccgcttgtggtccccattctgcgcgcaggc
cttggcatgctcgagggcatgaccaagctggtccccactgctgaggtcggcttcctgggc
atggcccgcgacgaagaaaccctggacattatcacctacgccgagcgcctccccgaggac
ctcaccggccgtcagatcttcgtcctcgaccccatgctcgcaactggtggcaccttgcgc
gaggccatcaagttcctgttcaagcgcggtgcctcggacgtgacctgcatttgcctgctg
gccgctccggagggattgtccaagctggaagaagagctctccgacgccaacgtgaagatc
gttctggcttccattgacgagaagctcaacgaaaagtcgtacatcgtgcccggcctgggc
gacgccggcgaccgcctgtacggcgtggcgggttaa

DBGET integrated database retrieval system