KEGG   Paenarthrobacter aurescens: AAur_0796Help
Entry
AAur_0796         CDS       T00447                                 

Definition
(GenBank) hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM10072
UniProt: A1R2Y3
Position
828896..829534
Genome map
AA seq 212 aa AA seqDB search
MPLHCWTEARTDYNSHWNCRRAVRLMMRRWPGMVQLSLRTQPDRLMLEFKRLKMAPLPRH
AVRKWVLLGAALIPWALGSFAVYVTSAQYSGLGIFESYGAFEGGSNLGNILWFLVWTGVS
AAVCWFLVRKPGAIGVIQPVSGALYCYGTPAALLVFPDAAMGFAISHVRAFTDDTALHSP
LVEFLVISGVGALACASLMSLVFRKERPQRTA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcattgctggacggaggctcggacggattacaactctcattggaactgccga
cgagcggtcaggctgatgatgcggaggtggccggggatggtacaactgtctttgcggacc
caaccagacagactgatgttggaattcaaacgcttgaagatggcgccgttgccgagacat
gccgtgcgtaagtgggtcctgctgggagctgccttgattccgtgggcactcggatccttc
gccgtttatgttacgtccgcgcagtattccggtctcggcatcttcgagtcttacggggcc
tttgagggcggttccaacctaggcaacatcttgtggttcctcgtgtggacaggggtctct
gctgcggtttgttggtttctggtacgaaagccgggcgccatcggagtgatccaacccgtg
tctggcgcactgtattgttacggcaccccggccgccctgttggtttttccagacgcagcc
atgggattcgccatttcgcacgtccgcgcgttcactgacgacactgccttgcattcgccc
ttggtcgagtttcttgttatcagcggcgtgggggccctggcttgcgcttccctcatgtcc
ctcgtattcaggaaagagagaccgcagaggacggcttag

DBGET integrated database retrieval system