KEGG   Paenarthrobacter aurescens: AAur_0804Help
Entry
AAur_0804         CDS       T00447                                 

Definition
(GenBank) putative transcriptional regulatory protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
837719..838441
Genome map
AA seq 240 aa AA seqDB search
MPQGYNPNSYGQLRAVPTAEPAPMTAPTPVIAQSDKLRPVANDNVARGFVLYMGIDEETA
AAAGTSIAKLAQEIRAYAQSLVTGAESYAAVAVAPAGAPGSALDVVRSTFGDPTVAARQR
TEAARPAPQQESRPSGVLIDLARREVHLDGESLNLTFKEFELLNYLVENGTRTVGRDELL
EGLWRNAEEVPNERTIDVHIRRLRSKLGRLANTVRTVRGQGYRFYEHPEVIVWAAPEYSI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagggctacaaccccaactcctacggccagttgcgcgcagtccccacagcagag
ccggcgcccatgacggcgcccacccctgtgattgcccagtcggacaagctccgccccgtt
gccaacgacaatgtagcccgcgggtttgtcctctacatgggcattgacgaagaaaccgca
gccgctgcaggaacgtccatcgccaaactcgcccaggaaatccgggcatacgctcagtcc
ctcgtgaccggcgcggagagctacgccgccgtcgcagttgcccccgccggggcacccggc
tcggcactcgacgtcgtgcgttccaccttcggtgaccccaccgttgccgcacgccagcgc
accgaggccgcacgtccggcgccgcagcaggaatcccgtccgtcgggcgtgctgatcgac
ctcgcacgccgcgaagtgcacctcgacggcgaatccctgaacctgacgttcaaggaattc
gaactcctcaactacctcgtcgagaacggcacccgcaccgtgggccgcgatgaactcctt
gagggcctgtggcgcaacgccgaagaggtgcccaacgagcgcaccatcgacgtccacatc
cgccgcctccgttccaagctcggccgccttgccaacaccgtccgtacggtccgaggccag
ggctaccgcttctacgagcaccccgaagttattgtttgggcagcacccgaatactcgatc
tag

DBGET integrated database retrieval system