KEGG   Paenarthrobacter aurescens: AAur_0807Help
Entry
AAur_0807         CDS       T00447                                 

Definition
(GenBank) putative transcriptional regulator, LysR family
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_28 HTH_30 HTH_5
Motif
Other DBs
NCBI-ProteinID: ABM06532
UniProt: A1R2Z4
Position
complement(839713..840630)
Genome map
AA seq 305 aa AA seqDB search
MIDISSLRALVAVEQHGSVVAASDVMGFSPSAISQQIKKLEKQTGVSVLERNGRGVLLTE
RGLALAGYGRRIMGELEELQATLLADPAKPSGLLRLVAFSTACRGLVGPMLGRMAAAHSA
LEVTVLAEDPREAVHRVASGEAELAVVHNWNSVPLVIPENLVHEDLCIDQADVLVNSTHA
LSGRAAVERGDLLDETWISTPAGAICNEALLQIFAGLGKVPDIRVYDPDFSTHIAMVEQG
VAVALVPRLGRPPLPAGVVAIPVIRPVQQRSVGVVYRKTMTASPNIRLAVSMLREIAAEL
PLPQG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatttcatcactgagggccttggtggccgtggaacagcacggctcagtagtg
gcagcatcagacgtgatgggtttcagcccttcggccatttcgcagcaaatcaagaaactt
gagaagcaaaccggcgtctccgtgctggaacgcaatggccgcggggtactcctcaccgag
cggggtttggccttggccggctatggccggaggatcatgggcgagcttgaagagctgcag
gccaccctgctcgccgacccagcgaaaccttcgggactcctgcggctcgttgcgttttcc
acggcttgccgcggcttggtgggacccatgctggggcgcatggccgctgcccactccgcc
ctggaggtcaccgttctggccgaggacccccgcgaggcggtccacagggtggcctcaggc
gaagcagaactcgcggtggtccacaactggaactccgtgcccctggtgatcccggagaac
ctggtgcatgaggacctgtgcatcgaccaagccgatgtcctcgtcaacagcacccacgca
ctttccggacgcgccgccgtcgagcgtggagatttgctggacgaaacctggatcagcacc
ccggcaggagccatctgcaacgaagcattgctgcagatcttcgccgggctgggcaaggtc
cccgatatccgcgtttacgatcccgatttctccacccacatcgccatggtggaacagggc
gtggccgtggcactcgttccgaggctcggcaggcctccgcttcccgccggcgtggttgcc
attccggtgatccggcctgtgcagcaacggtccgtgggcgtggtgtatcggaaaaccatg
acggccagccccaacattcgcttagctgtgagcatgctgcgcgaaatagcggccgaatta
cccctgccgcagggctga

DBGET integrated database retrieval system