KEGG   Paenarthrobacter aurescens: AAur_0810Help
Entry
AAur_0810         CDS       T00447                                 

Definition
(GenBank) tetracycline repressor protein (TetR family)
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C TetR_N
Motif
Other DBs
NCBI-ProteinID: ABM08198
UniProt: A1R2Z7
Position
complement(843253..843930)
Genome map
AA seq 225 aa AA seqDB search
MVQQAQSTDRRTRLDPATIIDAVLRISSQELGERLTVRRLGQELDVDATAVYRHFRNRDA
IVRAALDQLFMLSVERTQATARNQGWRARLEAYLDELLRSFMQHPSLGSESFATDTYGPG
ELKAIEFVLQCLTDAGLEEDRVVHYYAALESYTLALGAGIAVEIQRLPDSEGHDPWLNPG
VFTRITGHPLLEKHHAALQNLDSLKAFQAGLAAILDSAERESTQA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaagcacagtcgacggaccgccgcacgcgcctggacccagccaccatcatt
gacgccgtcctgcggatttccagccaggaactcggcgaacggctgacggtccgccggttg
ggacaggaactcgacgtggacgccaccgccgtctaccggcatttccggaaccgggacgcg
atcgtcagggcagcactggaccagctgttcatgctgtccgtggaacgaacacaggccacg
gcgcgcaaccagggatggcgtgcccggctggaggcctacctcgacgaactcctcaggtcc
ttcatgcaacacccctccttgggcagcgagtcgttcgccacggacacctacggtcccggt
gagttgaaagcgatcgagttcgtcctgcaatgcctcaccgacgccgggctggaagaggac
cgcgtggtgcactactacgcagccctggaaagctacaccttggcactcggcgcagggatt
gcggttgaaatccaacggctccctgattccgagggccacgatccttggctcaaccccgga
gttttcacgcgcatcaccgggcacccgctccttgaaaaacaccacgctgcactgcaaaac
ctcgattctctcaaagcgttccaagccggccttgcagccatcctggacagcgccgaacgc
gaaagcacgcaggcctga

DBGET integrated database retrieval system