KEGG   Paenarthrobacter aurescens: AAur_0814Help
Entry
AAur_0814         CDS       T00447                                 

Definition
(GenBank) putative ABC-type dipeptide/oligopeptide/nickel transport systems, permease components
  KO
K02034  peptide/nickel transport system permease protein
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02024  Quorum sensing
Module
aau_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AAur_0814
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    AAur_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF3742
Motif
Other DBs
NCBI-ProteinID: ABM07442
UniProt: A1R301
Position
848550..849407
Genome map
AA seq 285 aa AA seqDB search
MTLAIQLPQAGFRRYGSLLSPMAWGALAVAAAVVLLSLFAPVLAPYDPDYVDLNNVLAGP
SGQHLLGTDALGRDLLSRLMHGGRTSLLGPTIVVIGSTVLGLLLGLVAGWSEGWLGKVLG
RLFDLLFAFPALLMAMLAIALFGKGLFAPILAMTIAYVPYVARLAQSLVVAERSRPYVQA
YRVLGFRTPWVVLGRVLPNLIPTVGAQSTLNFGYVLADLAALSFIGLGVQPPTSDWGAMI
EESRGALLGGYILPAFWPALVVVLVVVAVNVIGEELSDRIGGKLS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgttagccatccagctgccgcaggcaggctttcgccgttacggaagcctcctgtca
ccgatggcgtggggtgcgcttgccgtcgctgccgccgtcgtacttctctcacttttcgcc
ccggtcctggcgccgtacgaccccgactatgtggacctcaacaacgtcctggccggtccc
agcgggcaacacctgctggggaccgacgcgctgggccgtgatctgctcagccggctcatg
catggcgggcggacctcgctgctggggcccaccatcgtggtgatcgggtccactgtgctc
ggcctgctgcttggcttggttgccggctggtcagagggctggctgggcaaggtcctcggc
aggcttttcgatctgttgttcgctttccctgcactgctgatggccatgctcgccatcgcc
ttgttcggcaaggggctcttcgctcccatcctggcgatgaccatcgcttatgtgccgtac
gtggccaggctggcccaatccctggtggttgccgagcgcagcaggccctacgtccaggcg
taccgggtgctcggattccggacgccctgggtggtgctgggacgggttctccccaacctg
attcccactgttggcgcgcagtcaacactgaactttggctatgtgctggccgacctcgcg
gcgctctccttcatcgggcttggggtccaaccacccaccagcgactggggcgccatgatc
gaggaatcccgtggcgccctgctgggcggctacatcctgcccgccttctggcccgcgttg
gtagtggtcctggtggtggttgccgtcaacgtcatcggcgaggaactctcagatcgcatc
ggaggaaaactttcatga

DBGET integrated database retrieval system