KEGG   Paenarthrobacter aurescens: AAur_0820Help
Entry
AAur_0820         CDS       T00447                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(856110..856910)
Genome map
AA seq 266 aa AA seqDB search
MLSVQQLQINGRRDDLLPATSLQVRRGELLLVAGEGQDQRTALALALSGRMKPSNGILSW
DATTKTKKIRLSSALVDSPGVNEPEQHLSVRDLVTEDLSLIPRRYRGALLSKPWLKVNSF
EDIAGLWIEQIPAARRLELLTALALADPATDLLVVDSPDRHSADPSAWLPRLQALASDAG
RPLAVVAVVGALPDNWTGAAAVIGNSVSHPPEPEAEAAPTQPKPAAVVEPKTEPETEPKA
KHAAQPASETTSAAHAESENLQRTAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccgtacagcaacttcagatcaacggccgccgggacgatctccttccggcaacg
tcacttcaagtccgccgcggcgaactcctgctcgtcgctggagagggccaggaccagagg
accgctttggcgttggctctgagcggccgcatgaagccaagcaacgggatcctcagctgg
gacgccaccaccaaaaccaagaagatccgcctctccagcgccttggtggactcccccggc
gtcaacgaacccgagcaacacctcagcgtccgcgacctcgtcaccgaagacctctccctc
atcccccgccgttaccgcggcgcgctgctgagcaaaccgtggctgaaggtcaacagcttt
gaagacatcgctggtctctggatagaacagattcccgccgctcgccgcttggaactcctc
accgcgctggccctggcagatccggccacggacctcctcgtggtggactccccggaccgc
cacagcgctgacccctcggcatggttgccccgacttcaggcattggcgtccgacgccggt
cggccgcttgccgtcgtcgccgtcgtgggtgccctcccggacaactggaccggcgccgct
gcggtgatcggcaactccgtctcgcacccgcctgaaccggaagctgaagccgcacccacc
cagcccaagccagcggccgtcgtcgagcccaaaaccgagcccgaaactgagcccaaagcc
aagcatgccgcccaaccggcgtctgaaactacatcggctgcccacgctgaatccgaaaac
cttcaaaggactgcaaagtga

DBGET integrated database retrieval system