KEGG   Paenarthrobacter aurescens: AAur_0833Help
Entry
AAur_0833         CDS       T00447                                 

Definition
(GenBank) putative flavohemoprotein
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     AAur_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 Globin NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: ABM06924
UniProt: A1R318
Position
complement(871220..872377)
Genome map
AA seq 385 aa AA seqDB search
MLSEKSRPIVEATLPLVGSRISAITVDFYNRLFAAHPELLDGLFSRSNQRSGDQQRALAG
SIAAFATHLINNPDTLPEKVLSRIAHKHASLGITEDQYGVVYEHLFAAIAADLAEVITPE
IAEAWTEVYWLMADALIKLEKDLYASQANHRMWMPWRVVNKEPAGTDAMTFTLEPADDTP
VTAAKPGQFVSVKVQLPDGLRQVRQYSLSGTAGSSRVFTTKLNDGGEVSTALHAGVEPGH
ILEISNPYGEITLREGAGPVILASAGIGCTPTASILRSLAATGTDRQVMVLHAEKTMENW
ALSDQMTADAAKIDAELQLWLESPQQGSKEGFMSLREVDMPADASLYLCGPLPFMKKIRD
EAIDAGIPATRIHYEVFGPDVWLAN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgctctcggaaaagtcccgccccatcgtcgaagccaccctgcctttggttgggtcacgg
atcagcgcgatcaccgtcgacttctacaatcggctcttcgccgcgcatcctgaattgctc
gatggactcttcagccgttccaaccaacgctcaggagatcagcagcgggcactcgccggg
agtatcgcggccttcgcgacccacctgatcaacaacccggacaccctccccgaaaaagta
ctctcccgcattgcccacaagcacgcgtccctcgggatcacggaggatcagtacggagtg
gtctacgagcatctcttcgcagccatcgcggcggacttggccgaggtcatcactccggag
atcgccgaagcatggacagaggtctactggctcatggcagatgccctgatcaagcttgaa
aaggacctctacgcatcccaggcaaaccacagaatgtggatgccctggcgtgtggtgaac
aaggagccggcaggcacggatgccatgacattcaccttggaaccggcggacgacaccccg
gtaacggcggcaaaacccggtcagttcgtcagcgtcaaggtccaacttcccgacggactg
cgccaggtgcgccagtattcgctttccggcacagcaggcagcagccgcgtgttcaccacc
aagctcaacgacggcggcgaggtgtccaccgccctgcacgccggcgtcgaacccggccac
atcctcgagatctcaaacccctacggcgaaatcaccctcagggaaggcgctggtcccgtc
atcctggcatccgcgggtatcggttgcactccaacggcgtccatcctgcggtcgctcgcg
gcgacgggcaccgatcggcaggtcatggttcttcatgccgaaaagaccatggaaaactgg
gcactcagtgaccagatgactgcagacgccgccaaaatcgatgccgagctgcagttatgg
cttgaaagtccccaacaaggttccaaggaaggcttcatgtcgctgcgcgaagtcgacatg
cccgcagatgcctcgctctatctgtgcggccctctccccttcatgaaaaagatccgcgac
gaagccatcgatgccggcattccggctactcgcatccactacgaagtctttggtccggac
gtgtggctcgccaactaa

DBGET integrated database retrieval system