KEGG   Paenarthrobacter aurescens: AAur_0836Help
Entry
AAur_0836         CDS       T00447                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
aau  Paenarthrobacter aurescens
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AAur_0836 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_0836 (manB)
Enzymes [BR:aau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     AAur_0836 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(873519..874937)
Genome map
AA seq 472 aa AA seqDB search
MTIEQNKTFDLSASFKAYDVRGIVGESITAEIVEAVGAAFIDVLGLEGETVLVGGDMRPS
SPEFSRAFANGAATRGANVQLLDLISTDELYYACGALNAAGATFTASHNPAAYNGIKMAK
AGAQPISSESGLKEIQALAEQYLNTGTIPAAVTRGEIGVHDVLKDYSEYLRKLVDLSGSR
PLKIVVDAGNGMAGLTTPAVLGDKLLPALPFEIIPLYFELDGSFPNHPANPLEPENLRDL
QAAVIKHGADIGLAFDGDADRCFVIDEKGEPVSPSAITGMVARREIARAQAAGEETPVII
HNLLTSKAVPELVAKDGGRAVRTRVGHSFIKAVMAEEGAVFGGEHSAHFYFRDFWNADTG
MLAAMHVLAALGEQDGPLSELGRQYEPYVSSGEINSEIEDKAGAVERVRVDFETEDIDID
HMDGSTFTAKDGSWWFNLRPSNTEPFLRLNAEAKDQATMEKIRDRVLALVRA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgactatcgagcagaacaagacattcgacctctcggcttccttcaaggcatacgacgtc
cggggcatcgtgggtgaatccatcacggctgaaatcgtcgaggccgtaggcgctgccttc
atcgatgtcttgggactcgagggcgaaacggtccttgttggcggcgacatgcgtccctca
tcgccggagttcagccgcgcctttgccaacggtgcagcaacgcgcggagcgaacgtccaa
ctgctcgacctgatctctaccgacgagctctactacgcatgtggcgccctcaacgctgcc
ggtgccacgttcacggcaagccataatccggccgcctacaacggcatcaagatggcaaag
gccggcgcccagcccatctcttccgagagtgggctcaaggaaatccaggccctcgctgag
cagtacctgaacaccggcaccatccctgcggcggtcactcgcggcgagattggcgtgcac
gacgtcctgaaggactactccgaatacttgcgcaaactggtggacctgtccgggtcccgc
ccgctgaagatcgtggtggatgcagggaacggcatggctggtttgaccaccccggctgtc
ttgggcgacaaattgctcccggctctgccctttgaaatcatcccgctctactttgaactg
gacggttcatttcccaaccacccggccaaccctctggagccggaaaacctgcgcgacctg
caggccgctgtcatcaagcacggcgccgacattggcctcgcgttcgacggcgacgcggac
cgctgctttgtcatcgacgaaaagggcgagcccgtttccccgtcagcgatcacgggcatg
gtggcccggcgtgagatcgcccgggcccaggccgcaggggaagagacccccgtcatcatc
cacaacctccttacctccaaggccgtgccagagctcgtagccaaggacggcggccgtgcc
gtacgtacccgcgtaggacactccttcatcaaggctgtcatggcggaggaaggcgccgtg
ttcggcggggagcactccgcgcacttctatttccgggatttctggaacgcggatacgggc
atgcttgccgcaatgcacgtccttgccgccttgggtgagcaggacggacctctctcggag
ctgggccgccagtacgagccctacgtctcctccggcgagatcaactccgaaatcgaagac
aaggccggcgccgtcgagcgcgttcgcgtcgacttcgaaaccgaagacatcgacatcgac
cacatggacggcagcacgttcacagcaaaggacggtagctggtggttcaaccttcgcccg
tccaacactgagcccttccttcgcctgaatgcagaagccaaggaccaagccaccatggaa
aagatccgcgaccgcgtcctggcgctggtccgggcgtag

DBGET integrated database retrieval system