KEGG   Paenarthrobacter aurescens: AAur_0840Help
Entry
AAur_0840         CDS       T00447                                 

Definition
(GenBank) putative prolyl oligopeptidase family protein
  KO
K01322  prolyl oligopeptidase [EC:3.4.21.26]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.26  prolyl oligopeptidase
     AAur_0840
Peptidases [BR:aau01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   AAur_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9 Peptidase_S9_N Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABM09747
UniProt: A1R324
Position
complement(879098..881353)
Genome map
AA seq 751 aa AA seqDB search
MTTTEADPTPLPENDAAPASGPRHAADVAPEPTDENVWLEDIHGEEQLAWVREQNARTEE
LLEDAEYEAVEAGILEVLDSTDRIAMVSKRGDFYYNFWKDQEHPKGLWRRTTWESYLTEE
PEWDVLLDIDALAAAEGVEWVFHGVGFLRPADGSEYRLAMVSLSPDGGDADRHREFDVES
RTFVEGGFDLPTAKGNVSWLDADTLLVSSTAEGLPATTSSYARTGVKLRRGQSLADAERL
FEIPEDHMLAMVAHDSTPGYERTFAVDYIDFYNRSTSLLRDDSWVVIDVPTDVNISAHRD
WLLFRPQKDWDVAGVLYPAGSLLAADFESYLAGTRSLLVLFTPDAHTSLQSWSWTKDYLL
LNLLRDVSSEIRVLDPSRPDSEGGWTSTVLDACPPLHDVNAYAVDDEDAGPEGNDFWLVA
TGFTTPTTLTRGTLGASSSGGASAGGGSEASGVASQHAEVKRSPSFFNEADYEVQQHFAV
SDDGTKVPYFQVASKDLVLDGQNPTQLSGYGGFEVSRTPAYSGTMGRAWLERRTLGASSD
DGAAAHSRGGVYVVANIRGGGEYGPSWHRAALQENRHRAYEDFAAVAKDLISRGVTSRRR
LGCVGGSNGGLLVGNMLTQYPELFGAVSCGVPLLDMRRYTKLSAGYSWIAEYGDPDVPAQ
WDFIRTFSPYHLLHDGVEYPETFIWTATSDDRVGPVQARKMAARMQAMGIPNVWFYEALE
GGHAGASDNRQAAALQARSNHFLWRSLAGSN
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacagaagctgatccgacgccactccccgagaatgacgctgcgccggcctcc
ggcccccgccacgcagcggacgtcgcgcccgaacccacggacgaaaacgtctggctcgag
gacatccacggcgaagagcagctggcgtgggtccgcgagcagaacgcccgcaccgaggaa
ctcttggaggacgccgaatatgaggccgttgaggccggcatcctggaggtcctcgactcc
accgatcgcatcgccatggtctccaaacgaggcgatttctactacaacttctggaaagac
caggaacaccccaagggcctctggcgccgcaccacctgggaaagctacctcaccgaagaa
cccgagtgggacgttctgctggacatcgacgccctcgccgccgctgaaggcgtcgagtgg
gtcttccacggcgttggcttcctccgtccagccgacggctccgagtaccgcctggccatg
gtttcgctatctcccgacggcggcgacgctgaccgccaccgcgagttcgacgtcgaatcc
cgcaccttcgtggagggtggctttgatctgcccaccgccaagggcaacgtcagctggctg
gacgccgacactttgctcgtatccagcacagccgaaggcctgccagcaactacctcgtcc
tatgcgcggactggcgtgaagctccgccgtggccagtcccttgccgacgccgagcgcctc
ttcgaaatccccgaggaccacatgctggccatggtggcccacgactccacgcctggctac
gagcggactttcgccgtggactacatcgacttctacaaccgcagtacatcgctgctgcgc
gacgactcctgggtggtcatcgacgttcccacggatgtgaacatcagcgcccaccgggat
tggctgctgttccgtccgcagaaggactgggatgttgccggtgttctctaccctgccggg
tccttgctggccgcggacttcgagtcctatctggcagggacccgttcactgctggtcctg
ttcacgccggatgcccacacgtcgctgcagtcgtggagctggaccaaggactacctcctg
ctgaacctcctgcgcgatgtgtcctccgagatccgggtgctggacccatcccgtcccgac
tccgaaggcggctggacgtccaccgtcctggacgcgtgcccgcccctgcacgacgtcaac
gcctacgccgtggatgacgaagacgctggccctgaaggcaacgacttttggctggtggcc
accggcttcacgacacccaccacattgacccgggggacgctcggtgcgtcgtcgtcgggt
ggtgcttcggcgggtggtggttcggaggccagtggcgtggcgagccagcacgccgaagtc
aagcggtcgccgtcgttcttcaacgaagccgactacgaagtccagcagcacttcgcggtg
tctgacgacgggaccaaggtcccctacttccaggtcgcttccaaggacctggtgctggac
gggcaaaaccccactcagctctccggatatggcgggttcgaggtttcgcggactccggca
tacagcggaaccatgggtcgggcctggctggagcgccgcaccttgggcgcatcctccgac
gacggtgctgccgcgcactcacgcggcggcgtctacgttgttgccaacatccgcggcggc
ggcgaatacggtccctcctggcaccgtgcagccctccaggaaaaccggcaccgcgcgtac
gaggacttcgcggccgtggcgaaggacctcatctcgcgaggcgtcaccagccgccgtcga
ctcggttgcgtaggtggttccaacggcggcctcctggtaggcaacatgctgacccaatat
ccggaactgttcggcgctgtgtcctgcggagtgccgctcctggacatgcgccgctacacc
aagctctccgccggatactcgtggatcgccgaatatggtgacccggatgtccccgcgcaa
tgggatttcatccgcaccttctcgccataccatttgcttcacgacggcgtggaatacccg
gagaccttcatttggaccgccacgtccgatgatcgtgtgggacccgtccaggcccgcaaa
atggcggcgcgaatgcaagccatgggcatcccgaacgtatggttttatgaagccctggaa
ggcggccacgcgggggcctccgacaacaggcaggccgcagcgcttcaggcccggagcaac
cacttcctgtggcgttcgctggctgggagcaactaa

DBGET integrated database retrieval system