KEGG   Paenarthrobacter aurescens: AAur_0844Help
Entry
AAur_0844         CDS       T00447                                 

Definition
(GenBank) putative glyoxalase family protein
  KO
K06996  
uncharacterized protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(889984..890769)
Genome map
AA seq 261 aa AA seqDB search
MPKPDITPGSPCWIDLVTSDTEKAKAFYTALFGWTYETGDQEKYGGYITASKNGRMVAGI
MEKQADMGAMPDVWSTYLRTDDIKATTEAAAANGGRVLMEPMEVPEQGSMAMYGDASGAA
IGAWQFGEMKGYEVAAEAGAPAWHELLSKDYESAVTFYQKVFGWDTEVMSDTPEFRYTTL
GAGDDAKAGIMDASGFLPEQVPSMWSVYFAVEDTDATAERAASLGATIMQPAEDTPFGRL
ATLSDPTGAVFKVIQDLGQTA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcctgacatcactcccggttccccctgctggatcgaccttgtgacgtccgat
acggagaaggccaaggccttttacacggcacttttcggctggacctatgaaaccggagac
caggaaaagtacggcggctacatcacggcttccaagaatggccggatggttgcgggcatc
atggagaagcaggcggacatgggggccatgccggacgtttggtccacctaccttcgcacc
gacgacatcaaagcaaccaccgaggccgctgccgccaacggcggccgggtgctcatggaa
cccatggaggtccccgagcaaggcagcatggccatgtacggggatgcctcaggcgccgca
atcggcgcctggcagttcggtgaaatgaagggctatgaggtggcggctgaggccggagct
cccgcctggcatgaactgctttccaaggactacgagtccgcggtcactttctaccagaag
gtcttcggctgggacacggaggtcatgagcgacactccggaattccgatacacaaccctg
ggtgccggtgacgacgccaaggcgggcatcatggatgcctccggtttcctgcccgagcag
gtcccctccatgtggagtgtgtatttcgcggtggaagacacggacgccactgctgagcga
gccgcgtccctcggtgccaccattatgcagcccgccgaggacacacccttcgggcgcttg
gccacgttatcggaccccaccggcgccgttttcaaggtgatccaggacttgggccagacc
gcctag

DBGET integrated database retrieval system