KEGG   Paenarthrobacter aurescens: AAur_0846Help
Entry
AAur_0846         CDS       T00447                                 

Definition
(GenBank) putative quinone oxidoreductase
  KO
K00344  NADPH2:quinone reductase [EC:1.6.5.5]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     AAur_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N DapB_N Glu_dehyd_C adh_short
Motif
Other DBs
NCBI-ProteinID: ABM08101
UniProt: A1R329
Position
891152..892135
Genome map
AA seq 327 aa AA seqDB search
MKAVYISEPGGPEVLEIREVPSPVPGEGEVLIDVVAAGLNRADVQQRRGFYPPPPGASEV
PGLEVSGRIAAFGPGVTKAFSVGDKVVALLSGGGYAQQVAVPAEQVLRIPDGVDLITAAS
LPEVAATVYSNLIMTAQLQPGETVLIHGATGGIGTMAIQLAKAYGAKVATTAGTDEKVGT
AKAFLGADIAINYTEEDFAESLKAHNGGKGADVILDVVGAKYLQQNIEALADYGRLIVIG
LQGGTKAEINLGQLLSKRAAVIGTALRPRPVTEKGIIMSAVRESVWPMLTDGRIKPLVAK
SFPLDQVREAHEYFDSGEHVGKVLLLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtctacatctcagagccaggcgggcccgaagtcctcgaaatccgcgaggtc
ccctctccggtgcccggcgagggcgaggtgctgatcgacgtcgtggctgcgggcctgaac
cgtgcggacgtccagcagcggcgtggcttctatccgccgcccccgggcgcctcggaagtt
cctggcttggaggtctccggccgcatcgccgctttcggccccggcgtcaccaaggcattc
tctgtgggggacaaagtagtggcactgttgtccggcggtggctacgcccagcaggtcgca
gtcccggcggagcaggttctccggattcccgacggcgtggacctgataacagcggcctcg
ctgcccgaagttgcggccacggtgtactcgaacctgatcatgaccgctcagctgcaaccc
ggcgagaccgtgctcatccacggtgcaaccggcggcatcggcaccatggccatccaactg
gccaaggcctatggcgcaaaggtggcaaccacggcgggcactgacgagaaagtgggtacc
gccaaggccttcctgggtgccgatatcgccatcaactacaccgaagaggattttgctgaa
agcctcaaggcgcataacggaggcaaaggcgcggacgtgatcctcgacgtcgtgggtgcc
aaatacctgcaacagaacatcgaggcgctcgccgactacggacgactcatcgtcatcggc
ctgcaaggtggtaccaaagctgagattaacctcggccagctcctcagcaaacgggctgcc
gtcatcggaacagccctccggccgcgaccggttactgaaaagggaatcatcatgtccgcc
gtgcgtgagtcggtgtggcccatgctcaccgatggccggatcaagccccttgtggccaag
tccttccccttggatcaagtccgggaagcgcatgaatactttgactccggcgagcacgtg
ggcaaagtcctcctgctcctctga

DBGET integrated database retrieval system