KEGG   Paenarthrobacter aurescens: AAur_0854Help
Entry
AAur_0854         CDS       T00447                                 

Definition
(GenBank) transcriptional regulator, AsnC family
  KO
K03718  Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA
Organism
aau  Paenarthrobacter aurescens
Brite
Transcription factors [BR:aau03000]
 Prokaryotic Type
  Helix-turn-helix
   Lrp/AsnC family
    AAur_0854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AsnC-type AsnC_trans_reg HTH_24 HTH_38 HTH_DeoR HTH_Tnp_ISL3 Phage_coat
Motif
Other DBs
NCBI-ProteinID: ABM07056
UniProt: A1R336
Position
898045..899001
Genome map
AA seq 318 aa AA seqDB search
MVVFDALERQIVAALQQDPRCPWRKMAAVLGEAERTVARRGSLLLESGSVAVVGIRPRPA
VVLVEMRCMPGTVRAASNALAQRADTTFVYTTTGTGDCVAEILTEPSRMGDVLSDELPST
IGLRDSTSYPVLRYFRTIRGWRPEVLAPDKAEALRSDLTKDSGILVPLQDLSRQDNELID
ALCADGRASFEALGRRVGVSEATARRRSEWLLANNHIQLRAIVEPAAFGLGVEALLWIRA
SPQHVERVGRSLAELPTVRYAAAIAGDYQIVADVTVEDMSSLYRFITDSEWAQEATGVDV
SILLDARKRGGRIMRSSS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgtttgacgcattggagcggcagatcgtggctgccctccaacaggatccccgc
tgcccttggcggaagatggcggccgtcctcggcgaagccgagcgaactgttgcccgccgg
ggatcgctgttgttggagtccggctccgtggctgtggtgggtatccggcccaggcccgcc
gtggtgctggtggagatgcgctgcatgcccggaacggttcgggcggcgtccaacgccctc
gcgcagcgtgccgacaccacgtttgtttacaccaccaccggcaccggtgactgcgtcgcg
gaaatactcacggaaccgtcccggatgggcgatgttctttccgatgagttgccctccacc
atcggcttgcgtgattccaccagctatcccgtgctccgttacttcaggaccatccgaggg
tggcggccggaggttctcgcccctgacaaagccgaagcgctccgatcggatctcaccaag
gattccggaatcctggtgccgctgcaggacctgagccgccaggataatgaactcatcgat
gccctgtgcgccgatggccgggcgagcttcgaagcgctggggcgccgtgttggcgtttcg
gaagcaactgcccggcgacgcagcgaatggttgctggccaacaatcacatccaattgcgg
gcgatcgttgaaccggctgcctttggactgggcgttgaggcccttctctggatccgcgca
tcgccgcagcatgttgagcgcgtgggacggagcctcgctgagcttcccacggttcgctat
gccgcggcgattgccggggactaccagatcgtggctgacgtcactgtggaggacatgtcg
tccctctaccgcttcatcaccgactcggagtgggcgcaggaggccaccggagtggatgtg
tccattcttctcgatgcgcggaagcgcggcggacggattatgcgctcatcgtcgtaa

DBGET integrated database retrieval system