KEGG   Paenarthrobacter aurescens: AAur_0880Help
Entry
AAur_0880         CDS       T00447                                 

Definition
(GenBank) putative transcriptional regulator, MarR family
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
926351..926809
Genome map
AA seq 152 aa AA seqDB search
MSIEDDALEVRARGWRTLAALHGLIEGELEQALQAEAGLSVVEYTVLDALARQDGWHMRM
QQLARATALSPSATTRLVNRLEGRGLLQRILCSDDRRGIYTELTSEGSELLISARPAHDI
ALEQALATAEETAELASLVRALPQLSTAVQIR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgaagatgacgccctggaagtacgggcccgaggttggcgaaccctggccgct
ttgcacggcctcattgagggtgaactcgagcaggcactccaggcagaggcaggcttgtcc
gtggtcgaatatacggttctcgacgcacttgccaggcaggatggctggcatatgagaatg
cagcaattggcgcgggcaactgcgctctcgcccagcgcaacgacgcgcctcgtgaatcgg
ctggagggccgagggctacttcagcggattctgtgctcagacgacagacgcggtatctac
accgagctcacaagcgaggggagcgagctgctcatttcagcccgccccgctcacgacatc
gcgcttgaacaggcgttggcaacggccgaggaaaccgcagaactcgcttcgctcgtgcgg
gcactgcctcagctgtccacggctgtccaaatccggtaa

DBGET integrated database retrieval system